Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367675 1149 bp mRNA linear INV 02-SEP-2023 (LOC131997173), mRNA. ACCESSION XM_059367675 VERSION XM_059367675.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1149 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1149 /gene="LOC131997173" /note="uncharacterized LOC131997173; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997173" CDS 23..1063 /gene="LOC131997173" /codon_start=1 /product="uncharacterized protein LOC131997173" /protein_id="XP_059223658.1" /db_xref="GeneID:131997173" /translation="MEELLNNTFDKIRKPKILTKYVDDIFAILKKSDVAETLKTLNSF NNYIQFTKEEEYDGKLPYLDSVVYRHGNQLKIDWYQKSTASGRLINFYSKHHKRVITN TATNFIRRVFSISDPDFHPDNERKIKAILRANDFPNWTINSLLGKAKERLGKIIDGEQ PTKGKIYKSLTYIQGFSERFGKSNLYDKDKYHLALKTGKTVNELFSKTKCKIKNEEKS NVVYKIRCNGDKSNICPMAYIGTTMTKLKTRLSAHKSDQKANNRPIEQKTALAAHCAL TGHKPNLNDVDILAQENNYRRRFTLEMLHIIDLPPDERMNFKKDIESCAKVYRHTVNK HSRREHLVANRQ" polyA_site 1149 /gene="LOC131997173" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acccattatt gctgacatcg taatggagga acttctcaat aacacatttg acaaaataag 61 aaaacctaag atattgacaa aatatgtaga cgacattttc gcgattttga agaaatcaga 121 cgtggcagag acgctgaaga ctctgaactc cttcaacaac tacatccaat ttacgaagga 181 agaagaatat gatggcaaac taccttattt ggactcggta gtttatagac atggcaacca 241 gctaaaaata gattggtatc agaaatcgac ggcttccgga agattaatca atttttactc 301 taaacaccac aagagagtaa taacaaacac agcaacgaat tttataagaa gagtatttag 361 cattagtgat ccagactttc atcctgacaa tgagaggaaa ataaaggcaa ttcttagagc 421 caacgacttc cctaattgga caattaattc actattaggc aaggccaagg aacgtcttgg 481 aaaaatcata gacggagagc agcctacaaa aggaaaaatt tataaatcgc taacatacat 541 acaaggattc tccgaaagat ttggcaaatc aaatctatac gacaaggaca aataccatct 601 cgcattaaaa acaggcaaaa ctgtgaatga attattcagc aagacaaaat gtaaaattaa 661 aaatgaggag aagtcaaacg tggtatataa aattagatgt aacggcgaca agtccaatat 721 atgcccgatg gcatatattg gcactaccat gacgaaattg aaaactaggt tatctgcaca 781 taaatctgac caaaaagcca ataatagacc aatcgagcag aaaactgcac tagcagccca 841 ctgtgcattg actggtcata agccaaacct caacgatgtg gacatcttag ctcaagagaa 901 caattacaga cgaagattca ctctcgagat gttgcatatc atcgacttac cgcctgacga 961 gagaatgaat ttcaagaaag atatagaaag ctgcgcgaag gtataccgcc acacagtcaa 1021 caagcacagc agaagagaac atttagttgc caacagacaa tagttcgtgt aacaactcat 1081 taaatccttg aaaatggtag acggagtcta ccgaaatatt ggagaaaaat aaaagaaaaa 1141 aaccttaaa