Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997173


LOCUS       XM_059367675            1149 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997173), mRNA.
ACCESSION   XM_059367675
VERSION     XM_059367675.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1149
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1149
                     /gene="LOC131997173"
                     /note="uncharacterized LOC131997173; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997173"
     CDS             23..1063
                     /gene="LOC131997173"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997173"
                     /protein_id="XP_059223658.1"
                     /db_xref="GeneID:131997173"
                     /translation="MEELLNNTFDKIRKPKILTKYVDDIFAILKKSDVAETLKTLNSF
                     NNYIQFTKEEEYDGKLPYLDSVVYRHGNQLKIDWYQKSTASGRLINFYSKHHKRVITN
                     TATNFIRRVFSISDPDFHPDNERKIKAILRANDFPNWTINSLLGKAKERLGKIIDGEQ
                     PTKGKIYKSLTYIQGFSERFGKSNLYDKDKYHLALKTGKTVNELFSKTKCKIKNEEKS
                     NVVYKIRCNGDKSNICPMAYIGTTMTKLKTRLSAHKSDQKANNRPIEQKTALAAHCAL
                     TGHKPNLNDVDILAQENNYRRRFTLEMLHIIDLPPDERMNFKKDIESCAKVYRHTVNK
                     HSRREHLVANRQ"
     polyA_site      1149
                     /gene="LOC131997173"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acccattatt gctgacatcg taatggagga acttctcaat aacacatttg acaaaataag
       61 aaaacctaag atattgacaa aatatgtaga cgacattttc gcgattttga agaaatcaga
      121 cgtggcagag acgctgaaga ctctgaactc cttcaacaac tacatccaat ttacgaagga
      181 agaagaatat gatggcaaac taccttattt ggactcggta gtttatagac atggcaacca
      241 gctaaaaata gattggtatc agaaatcgac ggcttccgga agattaatca atttttactc
      301 taaacaccac aagagagtaa taacaaacac agcaacgaat tttataagaa gagtatttag
      361 cattagtgat ccagactttc atcctgacaa tgagaggaaa ataaaggcaa ttcttagagc
      421 caacgacttc cctaattgga caattaattc actattaggc aaggccaagg aacgtcttgg
      481 aaaaatcata gacggagagc agcctacaaa aggaaaaatt tataaatcgc taacatacat
      541 acaaggattc tccgaaagat ttggcaaatc aaatctatac gacaaggaca aataccatct
      601 cgcattaaaa acaggcaaaa ctgtgaatga attattcagc aagacaaaat gtaaaattaa
      661 aaatgaggag aagtcaaacg tggtatataa aattagatgt aacggcgaca agtccaatat
      721 atgcccgatg gcatatattg gcactaccat gacgaaattg aaaactaggt tatctgcaca
      781 taaatctgac caaaaagcca ataatagacc aatcgagcag aaaactgcac tagcagccca
      841 ctgtgcattg actggtcata agccaaacct caacgatgtg gacatcttag ctcaagagaa
      901 caattacaga cgaagattca ctctcgagat gttgcatatc atcgacttac cgcctgacga
      961 gagaatgaat ttcaagaaag atatagaaag ctgcgcgaag gtataccgcc acacagtcaa
     1021 caagcacagc agaagagaac atttagttgc caacagacaa tagttcgtgt aacaactcat
     1081 taaatccttg aaaatggtag acggagtcta ccgaaatatt ggagaaaaat aaaagaaaaa
     1141 aaccttaaa