Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans peptidoglycan-recognition protein SA


LOCUS       XM_059367671             819 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081422), mRNA.
ACCESSION   XM_059367671
VERSION     XM_059367671.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..819
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..819
                     /gene="LOC106081422"
                     /note="peptidoglycan-recognition protein SA; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 21 Proteins"
                     /db_xref="GeneID:106081422"
     CDS             67..672
                     /gene="LOC106081422"
                     /codon_start=1
                     /product="peptidoglycan-recognition protein SA"
                     /protein_id="XP_059223654.1"
                     /db_xref="GeneID:106081422"
                     /translation="MSNLLGVLLFIVCLIVFAVGGNGTENIGVKPDCPRIKLKRQWGG
                     KPSTTINYRPVPVKYVIIHHTVTNECTTFLECAEILQNMQHHHLNGLDFDDIGYNFLI
                     GNDGNIYEGTGWYVRGAHTYGYNQNGTGIAFIGNFMGKLPSRKALQSAKHLLKCGVEV
                     GALDPNYDLLAATQVSSTKSPGLTLYNEIQEWDHWSPNISE"
     polyA_site      819
                     /gene="LOC106081422"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cattttctac ataacaaaga taactgagct tcgattttat ttcaatccat tatattttta
       61 acgaaaatgt ccaatttatt aggggtgttg ttgtttattg tttgtcttat tgtatttgct
      121 gttggtggaa atggcactga gaatatcggt gtcaaacccg actgtccacg tatcaaactt
      181 aaacggcaat ggggtggaaa accaagtacc acaataaatt atcgtcccgt gccggtgaaa
      241 tatgtcatta ttcatcacac ggtgaccaat gagtgtacca ccttcctgga atgtgcagaa
      301 atcttgcaga atatgcaaca tcatcatctt aatggactgg actttgatga tattggttac
      361 aacttcctta tcggtaacga tggcaacatt tatgaaggca ctggatggta tgtaagaggt
      421 gcccacacct atggctacaa tcaaaacggc accggaatag cattcattgg aaattttatg
      481 ggaaaattac cttcccgcaa agctttacaa tctgccaagc atctgctaaa gtgtggtgtc
      541 gaagtcggag cactagaccc aaattacgat cttttggcag ctactcaagt atcctctaca
      601 aaaagtccgg gcttaacgtt atacaatgaa atacaagaat gggatcattg gtcaccgaac
      661 atatcggaat agaaatttca tatattttag aacaggctaa aactgtataa taagcatcta
      721 gacatatcta acataagtgc acatcacatg ctaatttaac atccatttat atttattgct
      781 ttggagtttg caacataaaa aattcaaaat ctgatcata