Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997172


LOCUS       XM_059367668             763 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997172), mRNA.
ACCESSION   XM_059367668
VERSION     XM_059367668.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..763
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..763
                     /gene="LOC131997172"
                     /note="uncharacterized LOC131997172; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997172"
     CDS             1..330
                     /gene="LOC131997172"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997172"
                     /protein_id="XP_059223651.1"
                     /db_xref="GeneID:131997172"
                     /translation="MSSKRTLLSTSPDHKEHTPKKYAPSLNMSVSSHQDVFTWSKLCE
                     VLDDKLKGVAKKEDLTDIKHEIEELKHENSKLKEDIKKLTNRLELVDQKSRTTNIMVP
                     PAKSKGF"
ORIGIN      
        1 atgagcagca agcgcactct tttatcgaca tcacctgatc ataaagaaca tacaccaaaa
       61 aaatacgcgc cgtccctaaa tatgagtgta agcagtcatc aagacgtgtt tacatggagc
      121 aaactatgcg aagtcctgga cgacaaattg aagggtgtag caaagaaaga agatctgacg
      181 gatatcaaac atgaaattga agaattaaaa catgagaatt ctaaattaaa ggaagacata
      241 aagaaattaa caaaccgtct agaactagtt gaccagaaat cgagaaccac aaatatcatg
      301 gtaccgccag cgaagtccaa agggttttaa atgctagaag taaccttaag ggacaagcaa
      361 tttttattca gaaggattac actgcagctg aacagtctat tagatacaat ctcaggcaag
      421 ttagcaaagt aatatctaag cataaaaaag atgtaaaagt acggcttggt gaattttgta
      481 tctacatcaa cgataaacgc tttacttggt tcaatggaaa gatacgttct tccgctacaa
      541 acgatgtaaa atttctagaa gatatattag ctgaatgcgg ttttagttgt gaggttgttt
      601 gcaacgaaaa cgtagtatta aataaaaacg ataacaatcc ttatgtacaa tagctagctg
      661 attcgtgcca tataatagct tataacgttt gtaaccttga aaaatcgcta aattttggaa
      721 actttataac ctttttaaat aagtttgata ttttcttttt gtt