Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085113


LOCUS       XM_059367665             651 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085113), transcript variant X2, mRNA.
ACCESSION   XM_059367665
VERSION     XM_059367665.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..651
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..651
                     /gene="LOC106085113"
                     /note="uncharacterized LOC106085113; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085113"
     CDS             105..623
                     /gene="LOC106085113"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085113 isoform X2"
                     /protein_id="XP_059223648.1"
                     /db_xref="GeneID:106085113"
                     /translation="MLEYCTGGTLQDSNIYPPWICFMCIKQLEICFRFLKRYDLAQKE
                     FEASHNQFQEESSDFQSALLDEDGKVEKRICHANLSTNAEFSETSISSKQNTLEPSAV
                     QAPISEYSSSEGTTFGYRDSSQEPGVSLEGARNSYGDVVCSICNKTFLTGKGLNLHLK
                     LYHKQKNISLGQ"
     polyA_site      651
                     /gene="LOC106085113"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caggattcaa gggataatac caggattagt gaatcctggg ataataccca aaacgaaatt
       61 ttcttgtaaa gtaacaatgt aaaaacggtc acaatattgt caaaatgttg gaatattgta
      121 caggcggaac tcttcaagat tcaaatatat acccaccatg gatttgcttt atgtgcatta
      181 agcagttaga gatttgcttt cgttttctaa aacgatatga tctagcccaa aaggagttcg
      241 aagccagtca caatcaattt caggaagaat cttccgactt ccaatcagcg ttattagatg
      301 aagatggtaa agtggagaaa agaatttgcc atgccaatct cagcaccaat gcagaattta
      361 gtgaaacgag tataagttcc aaacaaaata ccttggagcc atcagcagtt caagcaccaa
      421 taagtgaata ttcatctagc gaaggaacaa ctttcgggta tagagattca tcacaggagc
      481 caggtgtaag tctagaaggc gctcggaatt cctatggaga tgtggtatgc tctatttgta
      541 ataagacctt tcttaccggc aaaggtttaa atttacacct taaattatat cacaaacaaa
      601 aaaacattag tttgggacaa taaatcaata agataaatct gttttatgtt g