Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367665 651 bp mRNA linear INV 02-SEP-2023 (LOC106085113), transcript variant X2, mRNA. ACCESSION XM_059367665 VERSION XM_059367665.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..651 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..651 /gene="LOC106085113" /note="uncharacterized LOC106085113; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085113" CDS 105..623 /gene="LOC106085113" /codon_start=1 /product="uncharacterized protein LOC106085113 isoform X2" /protein_id="XP_059223648.1" /db_xref="GeneID:106085113" /translation="MLEYCTGGTLQDSNIYPPWICFMCIKQLEICFRFLKRYDLAQKE FEASHNQFQEESSDFQSALLDEDGKVEKRICHANLSTNAEFSETSISSKQNTLEPSAV QAPISEYSSSEGTTFGYRDSSQEPGVSLEGARNSYGDVVCSICNKTFLTGKGLNLHLK LYHKQKNISLGQ" polyA_site 651 /gene="LOC106085113" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caggattcaa gggataatac caggattagt gaatcctggg ataataccca aaacgaaatt 61 ttcttgtaaa gtaacaatgt aaaaacggtc acaatattgt caaaatgttg gaatattgta 121 caggcggaac tcttcaagat tcaaatatat acccaccatg gatttgcttt atgtgcatta 181 agcagttaga gatttgcttt cgttttctaa aacgatatga tctagcccaa aaggagttcg 241 aagccagtca caatcaattt caggaagaat cttccgactt ccaatcagcg ttattagatg 301 aagatggtaa agtggagaaa agaatttgcc atgccaatct cagcaccaat gcagaattta 361 gtgaaacgag tataagttcc aaacaaaata ccttggagcc atcagcagtt caagcaccaa 421 taagtgaata ttcatctagc gaaggaacaa ctttcgggta tagagattca tcacaggagc 481 caggtgtaag tctagaaggc gctcggaatt cctatggaga tgtggtatgc tctatttgta 541 ataagacctt tcttaccggc aaaggtttaa atttacacct taaattatat cacaaacaaa 601 aaaacattag tttgggacaa taaatcaata agataaatct gttttatgtt g