Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367648 482 bp mRNA linear INV 02-SEP-2023 (LOC131997164), mRNA. ACCESSION XM_059367648 VERSION XM_059367648.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..482 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..482 /gene="LOC131997164" /note="uncharacterized LOC131997164; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997164" CDS 92..430 /gene="LOC131997164" /codon_start=1 /product="uncharacterized protein LOC131997164" /protein_id="XP_059223631.1" /db_xref="GeneID:131997164" /translation="MEIRNFITTRQWNRGSGVNGLKNSKKTTTEDQMWAAGGLLRDVR LPRFSKIIKEIADGIRAGGGLMREVCLSKLPKRTNEIADGIGTGSLSNDKDAKCHVYY FGNDANDKKT" polyA_site 482 /gene="LOC131997164" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggaaataaaa tgacatgttt tttaattttc accaatttgt ttttttttca atacctaaaa 61 aaattcttca tcaatataaa tattttaaat aatggaaata cgaaatttta ttacaactag 121 acaatggaat cgggggtcag gcgtgaatgg gttaaaaaac tctaaaaaaa ccacaacaga 181 agaccaaatg tgggccgctg gaggactttt gcgagatgtg cgtcttccaa gattctccaa 241 aataatcaag gaaattgcag atggaattag agctggtggt ggacttatgc gagaggtgtg 301 cctatcaaaa ttgcccaaaa gaactaacga aattgctgat ggaattggaa ctggttccct 361 gtctaatgat aaggatgcca aatgtcatgt ttactatttt ggaaatgatg caaacgataa 421 gaagacataa tgcgaaaaag aaaacaactc agaagagatt tacatagatg attttaatgt 481 ta