Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997164


LOCUS       XM_059367648             482 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997164), mRNA.
ACCESSION   XM_059367648
VERSION     XM_059367648.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..482
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..482
                     /gene="LOC131997164"
                     /note="uncharacterized LOC131997164; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997164"
     CDS             92..430
                     /gene="LOC131997164"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997164"
                     /protein_id="XP_059223631.1"
                     /db_xref="GeneID:131997164"
                     /translation="MEIRNFITTRQWNRGSGVNGLKNSKKTTTEDQMWAAGGLLRDVR
                     LPRFSKIIKEIADGIRAGGGLMREVCLSKLPKRTNEIADGIGTGSLSNDKDAKCHVYY
                     FGNDANDKKT"
     polyA_site      482
                     /gene="LOC131997164"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggaaataaaa tgacatgttt tttaattttc accaatttgt ttttttttca atacctaaaa
       61 aaattcttca tcaatataaa tattttaaat aatggaaata cgaaatttta ttacaactag
      121 acaatggaat cgggggtcag gcgtgaatgg gttaaaaaac tctaaaaaaa ccacaacaga
      181 agaccaaatg tgggccgctg gaggactttt gcgagatgtg cgtcttccaa gattctccaa
      241 aataatcaag gaaattgcag atggaattag agctggtggt ggacttatgc gagaggtgtg
      301 cctatcaaaa ttgcccaaaa gaactaacga aattgctgat ggaattggaa ctggttccct
      361 gtctaatgat aaggatgcca aatgtcatgt ttactatttt ggaaatgatg caaacgataa
      421 gaagacataa tgcgaaaaag aaaacaactc agaagagatt tacatagatg attttaatgt
      481 ta