Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367642 534 bp mRNA linear INV 02-SEP-2023 (LOC106087418), mRNA. ACCESSION XM_059367642 VERSION XM_059367642.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..534 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..534 /gene="LOC106087418" /note="uncharacterized LOC106087418; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:106087418" CDS 64..513 /gene="LOC106087418" /codon_start=1 /product="uncharacterized protein LOC106087418" /protein_id="XP_059223625.1" /db_xref="GeneID:106087418" /translation="MKSFTFFFIMLCVKQSLQQTDTSPLLEMAKTSVIDCYEDDAKTK KIEITDDGFQDIVKGSRDAVRNAKCIRYCIMKKHELFTPDNSLDETAVVPFFTYLFNN AIDIFHLKGIIASCNDGIAQETDRCERSHKATMCILEKLYTAGMKNV" ORIGIN 1 atcttctatt gacttaaact ttgaagcaga tttaattttt acaaaaaaaa atttgctttg 61 acaatgaaaa gttttacttt cttttttatc atgctttgtg tcaagcaatc gttgcagcaa 121 acggacacct ctccattatt ggaaatggcc aaaacttctg taatagactg ctatgaagac 181 gatgccaaaa ccaagaaaat tgaaatcact gatgatggct tccaggacat tgtcaagggc 241 tctcgcgatg ctgtacgcaa tgccaaatgt attcgctatt gtattatgaa aaaacatgag 301 ctgttcactc ccgataattc tttggatgaa accgctgtgg tacccttctt cacatatctc 361 tttaataatg ccatagatat tttccacctc aagggaatca tagccagttg taatgatggc 421 attgctcaag aaaccgatcg ttgtgaacgt tcgcataagg ctaccatgtg catcttggag 481 aaactttata cagctggaat gaagaatgtt taatgaataa aattttgaat aaaa