Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106087418


LOCUS       XM_059367642             534 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087418), mRNA.
ACCESSION   XM_059367642
VERSION     XM_059367642.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..534
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..534
                     /gene="LOC106087418"
                     /note="uncharacterized LOC106087418; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 15
                     Proteins"
                     /db_xref="GeneID:106087418"
     CDS             64..513
                     /gene="LOC106087418"
                     /codon_start=1
                     /product="uncharacterized protein LOC106087418"
                     /protein_id="XP_059223625.1"
                     /db_xref="GeneID:106087418"
                     /translation="MKSFTFFFIMLCVKQSLQQTDTSPLLEMAKTSVIDCYEDDAKTK
                     KIEITDDGFQDIVKGSRDAVRNAKCIRYCIMKKHELFTPDNSLDETAVVPFFTYLFNN
                     AIDIFHLKGIIASCNDGIAQETDRCERSHKATMCILEKLYTAGMKNV"
ORIGIN      
        1 atcttctatt gacttaaact ttgaagcaga tttaattttt acaaaaaaaa atttgctttg
       61 acaatgaaaa gttttacttt cttttttatc atgctttgtg tcaagcaatc gttgcagcaa
      121 acggacacct ctccattatt ggaaatggcc aaaacttctg taatagactg ctatgaagac
      181 gatgccaaaa ccaagaaaat tgaaatcact gatgatggct tccaggacat tgtcaagggc
      241 tctcgcgatg ctgtacgcaa tgccaaatgt attcgctatt gtattatgaa aaaacatgag
      301 ctgttcactc ccgataattc tttggatgaa accgctgtgg tacccttctt cacatatctc
      361 tttaataatg ccatagatat tttccacctc aagggaatca tagccagttg taatgatggc
      421 attgctcaag aaaccgatcg ttgtgaacgt tcgcataagg ctaccatgtg catcttggag
      481 aaactttata cagctggaat gaagaatgtt taatgaataa aattttgaat aaaa