Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans putative sulfiredoxin


LOCUS       XM_059367624             665 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084421), transcript variant X5, mRNA.
ACCESSION   XM_059367624
VERSION     XM_059367624.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..665
                     /gene="LOC106084421"
                     /note="putative sulfiredoxin; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106084421"
     CDS             16..606
                     /gene="LOC106084421"
                     /codon_start=1
                     /product="putative sulfiredoxin isoform X5"
                     /protein_id="XP_059223607.1"
                     /db_xref="GeneID:106084421"
                     /translation="MTKPWEFSLVQVAVIFLLVGLLGAFNNHSTAQMLSTTATSCVDR
                     SVHSANIDEIHNVPMNVIHRPIPPVLDENKVKSIMETLESEKTSDNVPPIDVLWIKGS
                     KGGNYFYSFGGCHRFEAYKRLNRDTIKAKLVNSTLSDLYTYMGSSTPKNLVQVLVWPK
                     TNTDNNVQKHPKLYRTHQLKVAYIFCLHRPPEEFCF"
ORIGIN      
        1 ctacattatc catgcatgac aaaaccttgg gagttttctt tggttcaggt ggctgttatt
       61 ttcttactcg taggattact aggtgctttc aataatcatt caaccgcaca aatgctttca
      121 accactgcaa cttcttgtgt cgatcgtagt gtacattcag ccaatatcga tgaaattcac
      181 aatgtaccta tgaatgtcat tcaccggcca atacccccag tgctagatga aaacaaagtg
      241 aaatcaataa tggagacctt agagagtgaa aaaacctccg ataatgtacc accgatagat
      301 gtcttgtgga tcaaggggtc gaagggagga aactactttt atagttttgg tggttgtcat
      361 cgttttgagg cctataagcg tcttaaccgt gataccataa aagcaaaact agtaaattct
      421 actctgtccg acttgtacac ctatatggga tcgagtacac ccaaaaactt ggtccaagtt
      481 ctagtttggc caaaaacaaa cactgataac aatgtacaaa aacatccaaa actttataga
      541 actcaccaat tgaaagtcgc atacatattt tgtttgcaca gaccaccgga ggagttttgt
      601 ttctaaggag tgatgatgaa tccaaacata aacctcaaac tcatctgtta agaaagttca
      661 tcgcg