Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367622 477 bp mRNA linear INV 02-SEP-2023 (LOC106084114), mRNA. ACCESSION XM_059367622 VERSION XM_059367622.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..477 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..477 /gene="LOC106084114" /note="uncharacterized LOC106084114; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106084114" CDS 44..370 /gene="LOC106084114" /codon_start=1 /product="uncharacterized protein LOC106084114" /protein_id="XP_059223605.1" /db_xref="GeneID:106084114" /translation="MFHKQYIVVFWLLVLVAAGTKASQDFRSYGHKRHPTLDNHCYYE DHNLTIKVNETIFPTNIEHYCYKMFCRRFEDDYVVDASYCPRGAPVCGKPDYSKPFPE CCSICK" polyA_site 477 /gene="LOC106084114" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tggaaaccga tagatttacc caggcatcac tcagttgtag aaaatgttcc acaagcaata 61 catcgtcgtt ttttggctgt tggttttggt tgctgccggg accaaggcgt cacaagactt 121 tcgtagttac gggcataaaa ggcatcccac tctggacaat cattgttact atgaggatca 181 taacctaacc attaaagtca atgagactat attccccaca aacattgaac attattgcta 241 caaaatgttt tgtcgtagat ttgaagatga ttatgtggta gatgcctcgt actgtcctcg 301 aggtgctccg gtttgtggta aacccgacta ctctaagcca tttccagaat gttgtagcat 361 ttgtaaatga caaaaggttc aaagaaattc ataacaaaaa attaaagcaa taagtctttt 421 caataagaag gctgaaataa atgtaaagaa accagaaggt atttctgtaa aaaatca