Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106084114


LOCUS       XM_059367622             477 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106084114), mRNA.
ACCESSION   XM_059367622
VERSION     XM_059367622.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..477
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..477
                     /gene="LOC106084114"
                     /note="uncharacterized LOC106084114; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106084114"
     CDS             44..370
                     /gene="LOC106084114"
                     /codon_start=1
                     /product="uncharacterized protein LOC106084114"
                     /protein_id="XP_059223605.1"
                     /db_xref="GeneID:106084114"
                     /translation="MFHKQYIVVFWLLVLVAAGTKASQDFRSYGHKRHPTLDNHCYYE
                     DHNLTIKVNETIFPTNIEHYCYKMFCRRFEDDYVVDASYCPRGAPVCGKPDYSKPFPE
                     CCSICK"
     polyA_site      477
                     /gene="LOC106084114"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tggaaaccga tagatttacc caggcatcac tcagttgtag aaaatgttcc acaagcaata
       61 catcgtcgtt ttttggctgt tggttttggt tgctgccggg accaaggcgt cacaagactt
      121 tcgtagttac gggcataaaa ggcatcccac tctggacaat cattgttact atgaggatca
      181 taacctaacc attaaagtca atgagactat attccccaca aacattgaac attattgcta
      241 caaaatgttt tgtcgtagat ttgaagatga ttatgtggta gatgcctcgt actgtcctcg
      301 aggtgctccg gtttgtggta aacccgacta ctctaagcca tttccagaat gttgtagcat
      361 ttgtaaatga caaaaggttc aaagaaattc ataacaaaaa attaaagcaa taagtctttt
      421 caataagaag gctgaaataa atgtaaagaa accagaaggt atttctgtaa aaaatca