Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mpv17-like protein (LOC106095676),


LOCUS       XM_059367621             769 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X1, mRNA.
ACCESSION   XM_059367621
VERSION     XM_059367621.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..769
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..769
                     /gene="LOC106095676"
                     /note="mpv17-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106095676"
     CDS             75..692
                     /gene="LOC106095676"
                     /codon_start=1
                     /product="mpv17-like protein"
                     /protein_id="XP_059223604.1"
                     /db_xref="GeneID:106095676"
                     /translation="MMPLVSNIIRTQWKAFRTTHPLKRGSIAYALLWPTSSLVQQSFE
                     GKNFGTYEYTSALRFGILGSLYVAPALYVWVRVSSAMWPQMSLRIGLLKAAVEQVSFA
                     PFIYGSFFAGMTLLEGKPIRTAMEEVKNKFIPTYKVGLYFWPILQTINFSMVPERHRL
                     VYLSLCSLMWTIFLAYMKKTSITEETPFRIEEKITWSRKPNLATL"
     polyA_site      769
                     /gene="LOC106095676"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atcatttaaa agcaaacttt gttaatctct aacaagaaaa ctaataaaaa acaatttttt
       61 tctaagacat acaaatgatg cctttagtat caaatatcat aagaacacag tggaaagctt
      121 ttagaaccac tcaccccctg aaaaggggat ccatagccta tgctctgcta tggccaacga
      181 gtagtcttgt tcaacaatca tttgagggta aaaattttgg aacctacgaa tataccagtg
      241 ccttaagatt cggtatactt ggttccttat acgtagctcc tgccttatat gtttgggtaa
      301 gggtatcgtc agctatgtgg ccacaaatgt cattaagaat tggtttgtta aaggctgctg
      361 tcgaacaagt gtcctttgca ccctttatct atggtagttt ttttgcgggt atgactttgc
      421 tcgaaggcaa acccatacga actgctatgg aggaggtgaa aaataaattt atacctacat
      481 ataaggtggg cctgtatttt tggcccattt tacagacaat aaatttttcc atggtccccg
      541 aaaggcatcg tttggtatat ttaagcctat gcagtcttat gtggacaata tttttggcct
      601 acatgaagaa aacgagtata acagaagaaa caccatttag aatagaggag aaaataacat
      661 ggagcagaaa accaaacttg gcgacgttgt agctaatttc caatattttt taaatttaaa
      721 tatcttatta aactgaaggt gataataaaa ttgtatttat ttattttta