Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367620 987 bp mRNA linear INV 02-SEP-2023 transcript variant X1, mRNA. ACCESSION XM_059367620 VERSION XM_059367620.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..987 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..987 /gene="LOC106095674" /note="mpv17-like protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106095674" CDS 16..870 /gene="LOC106095674" /codon_start=1 /product="mpv17-like protein isoform X1" /protein_id="XP_059223603.1" /db_xref="GeneID:106095674" /translation="MQLRWFLLGFQKIFYKIQISVLSTIRDIRSAKQKDFLQITFENK NIVIKKSKVNKISIKQKHLCKKIPVIYVYKMPVVINFVRTQWRAFTNTHPLLRGCITY GVLWPTSSLIQQTMEGKNLRTYDYMRALRFGIFGSLYVAPSLYGWVKLTSAMWPQMSL RIGLVKAAIEQLSYGPFACASFFAGMSLLEGKTMQEAVQEVEKKFFPTFKVGICIWPI LQTINFSMVPERNRLVFTSICSLMWTTFLAFMKMMDMQEDEALKTNTEVTPHKNAEII RGKPYLPM" ORIGIN 1 attacaccac ataccatgca gctgaggtgg tttcttctgg gatttcaaaa gattttttac 61 aaaatacaaa ttagtgtact ctcaactatt cgggatataa gatcggcaaa acaaaaagac 121 tttctacaaa tcacctttga aaataaaaac atagtgatca aaaagtcaaa agtgaacaaa 181 atatcaatca agcaaaaaca tctttgtaag aaaatacctg tcatttatgt gtataagatg 241 cctgtagtaa taaattttgt aagaacccag tggagagcat tcacaaacac ccatcccttg 301 ttaagaggtt gtataaccta tggcgtacta tggcccacaa gtagtctgat acaacaaacc 361 atggagggta aaaatttgcg tacctatgat tacatgcgtg ccttaagatt tggaatattt 421 ggctcgctgt atgtggcgcc cagtttatat ggatgggtaa agttaacctc agccatgtgg 481 ccccaaatgt cgttgcgcat aggcctggtt aaggcggcta tcgaacaatt atcctatgga 541 ccatttgcct gtgccagctt ctttgccggc atgtctttgt tggagggaaa gactatgcaa 601 gaagctgtac aggaagtgga gaaaaaattc tttcccacat ttaaggttgg catttgcatc 661 tggcccattt tacagaccat caacttttcc atggttcccg aacgtaatcg tttagtattt 721 accagcattt gcagtctcat gtggaccacc tttttggcct tcatgaaaat gatggatatg 781 caagaggacg aagctcttaa aacaaacaca gaagtcacac ctcataaaaa tgccgaaata 841 atacggggga aaccctactt gccgatgtaa atttttcttt tattaatttt agcatataaa 901 ccctagtgca attgtttttg tttttagtat aagcaacctt aatgttaata tgtacatatg 961 tatgtactat gtagctttat attgagt