Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mpv17-like protein (LOC106095674),


LOCUS       XM_059367620             987 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X1, mRNA.
ACCESSION   XM_059367620
VERSION     XM_059367620.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..987
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..987
                     /gene="LOC106095674"
                     /note="mpv17-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106095674"
     CDS             16..870
                     /gene="LOC106095674"
                     /codon_start=1
                     /product="mpv17-like protein isoform X1"
                     /protein_id="XP_059223603.1"
                     /db_xref="GeneID:106095674"
                     /translation="MQLRWFLLGFQKIFYKIQISVLSTIRDIRSAKQKDFLQITFENK
                     NIVIKKSKVNKISIKQKHLCKKIPVIYVYKMPVVINFVRTQWRAFTNTHPLLRGCITY
                     GVLWPTSSLIQQTMEGKNLRTYDYMRALRFGIFGSLYVAPSLYGWVKLTSAMWPQMSL
                     RIGLVKAAIEQLSYGPFACASFFAGMSLLEGKTMQEAVQEVEKKFFPTFKVGICIWPI
                     LQTINFSMVPERNRLVFTSICSLMWTTFLAFMKMMDMQEDEALKTNTEVTPHKNAEII
                     RGKPYLPM"
ORIGIN      
        1 attacaccac ataccatgca gctgaggtgg tttcttctgg gatttcaaaa gattttttac
       61 aaaatacaaa ttagtgtact ctcaactatt cgggatataa gatcggcaaa acaaaaagac
      121 tttctacaaa tcacctttga aaataaaaac atagtgatca aaaagtcaaa agtgaacaaa
      181 atatcaatca agcaaaaaca tctttgtaag aaaatacctg tcatttatgt gtataagatg
      241 cctgtagtaa taaattttgt aagaacccag tggagagcat tcacaaacac ccatcccttg
      301 ttaagaggtt gtataaccta tggcgtacta tggcccacaa gtagtctgat acaacaaacc
      361 atggagggta aaaatttgcg tacctatgat tacatgcgtg ccttaagatt tggaatattt
      421 ggctcgctgt atgtggcgcc cagtttatat ggatgggtaa agttaacctc agccatgtgg
      481 ccccaaatgt cgttgcgcat aggcctggtt aaggcggcta tcgaacaatt atcctatgga
      541 ccatttgcct gtgccagctt ctttgccggc atgtctttgt tggagggaaa gactatgcaa
      601 gaagctgtac aggaagtgga gaaaaaattc tttcccacat ttaaggttgg catttgcatc
      661 tggcccattt tacagaccat caacttttcc atggttcccg aacgtaatcg tttagtattt
      721 accagcattt gcagtctcat gtggaccacc tttttggcct tcatgaaaat gatggatatg
      781 caagaggacg aagctcttaa aacaaacaca gaagtcacac ctcataaaaa tgccgaaata
      841 atacggggga aaccctactt gccgatgtaa atttttcttt tattaatttt agcatataaa
      901 ccctagtgca attgtttttg tttttagtat aagcaacctt aatgttaata tgtacatatg
      961 tatgtactat gtagctttat attgagt