Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095114


LOCUS       XM_059367603             580 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095114), mRNA.
ACCESSION   XM_059367603
VERSION     XM_059367603.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..580
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..580
                     /gene="LOC106095114"
                     /note="uncharacterized LOC106095114; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106095114"
     CDS             44..448
                     /gene="LOC106095114"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095114"
                     /protein_id="XP_059223586.1"
                     /db_xref="GeneID:106095114"
                     /translation="MVLFKFVLIALSTLQMINNANSTEVDGDFCNRQHLKLEMEGSTN
                     IEVDSCEDFYDYDCGNWTQRVHCDQSDHLNKLPLENSTGLEQQAYEFYQSCNNIEFFS
                     TRAYLLWLELTKNLSLSTILTSRELWIWRKHW"
ORIGIN      
        1 ataagagatt tattgtcgga ccgcctgacg aacacagcag aaaatggttc tattcaaatt
       61 tgttctcata gcactttcaa cactccagat gataaacaat gcgaactcta cagaggttga
      121 tggagatttt tgcaaccggc aacatcttaa gcttgagatg gaaggttcta cgaatattga
      181 agtcgattct tgcgaggatt tctatgacta tgactgtggt aattggaccc aacgtgtaca
      241 ctgtgatcaa tctgaccacc taaataaact gccattggaa aacagtactg gattggaaca
      301 gcaggcctat gagttttatc aatcctgcaa taatatcgag ttcttctcga cgagggcgta
      361 cttactgtgg ctggagctta ccaagaattt aagcctatct acgatcctta cttcgaggga
      421 gctatggatt tggcggaaac attggtagtt ttacacaagc aagactctat agcgtttttg
      481 tgaactttat cggagcaaaa aatgaggatt tctctgaaga agaaagtccc acaaaattgt
      541 ctacagcttt gatctccttg attggaaaat aaatggatta