Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367603 580 bp mRNA linear INV 02-SEP-2023 (LOC106095114), mRNA. ACCESSION XM_059367603 VERSION XM_059367603.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..580 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..580 /gene="LOC106095114" /note="uncharacterized LOC106095114; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106095114" CDS 44..448 /gene="LOC106095114" /codon_start=1 /product="uncharacterized protein LOC106095114" /protein_id="XP_059223586.1" /db_xref="GeneID:106095114" /translation="MVLFKFVLIALSTLQMINNANSTEVDGDFCNRQHLKLEMEGSTN IEVDSCEDFYDYDCGNWTQRVHCDQSDHLNKLPLENSTGLEQQAYEFYQSCNNIEFFS TRAYLLWLELTKNLSLSTILTSRELWIWRKHW" ORIGIN 1 ataagagatt tattgtcgga ccgcctgacg aacacagcag aaaatggttc tattcaaatt 61 tgttctcata gcactttcaa cactccagat gataaacaat gcgaactcta cagaggttga 121 tggagatttt tgcaaccggc aacatcttaa gcttgagatg gaaggttcta cgaatattga 181 agtcgattct tgcgaggatt tctatgacta tgactgtggt aattggaccc aacgtgtaca 241 ctgtgatcaa tctgaccacc taaataaact gccattggaa aacagtactg gattggaaca 301 gcaggcctat gagttttatc aatcctgcaa taatatcgag ttcttctcga cgagggcgta 361 cttactgtgg ctggagctta ccaagaattt aagcctatct acgatcctta cttcgaggga 421 gctatggatt tggcggaaac attggtagtt ttacacaagc aagactctat agcgtttttg 481 tgaactttat cggagcaaaa aatgaggatt tctctgaaga agaaagtccc acaaaattgt 541 ctacagcttt gatctccttg attggaaaat aaatggatta