Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997146


LOCUS       XM_059367596             503 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997146), mRNA.
ACCESSION   XM_059367596
VERSION     XM_059367596.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..503
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..503
                     /gene="LOC131997146"
                     /note="uncharacterized LOC131997146; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131997146"
     CDS             84..461
                     /gene="LOC131997146"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997146"
                     /protein_id="XP_059223579.1"
                     /db_xref="GeneID:131997146"
                     /translation="MEVLNPRFTGLTNFHVMEWLRSINHTKKKCGLRNLATITNETQQ
                     FLEESPCKYQSRESIRGFLNDMEPYTLSMKELFKMINDPPSSALHIQLLFKESEERLS
                     EDQVNEIIRISKRHFPGPPPESN"
ORIGIN      
        1 tcctcgattg taaactcctt tcacattgtg tactactcca catttacaaa ataaaaattg
       61 taaacaaaca ataagcagag aacatggaag ttcttaatcc tcgttttact ggtttgacga
      121 acttccatgt catggaatgg ctaaggagta ttaatcatac aaaaaagaag tgtggactaa
      181 ggaacttggc caccatcact aatgaaaccc aacagttttt ggaggaatct ccatgcaaat
      241 atcagagccg tgaaagcatt agagggtttt taaatgatat ggaaccttac acattgagta
      301 tgaaggagtt gttcaagatg atcaacgacc caccttctag tgctttgcac atacagttgt
      361 tatttaaaga aagtgaggaa cgtttaagcg aggaccaagt taatgaaatt atacgaatat
      421 caaagagaca ctttccaggt cctccgcctg agtcaaatta ataataaaga atattagact
      481 tgctgttttt ctacgtacat ata