Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367596 503 bp mRNA linear INV 02-SEP-2023 (LOC131997146), mRNA. ACCESSION XM_059367596 VERSION XM_059367596.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..503 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..503 /gene="LOC131997146" /note="uncharacterized LOC131997146; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131997146" CDS 84..461 /gene="LOC131997146" /codon_start=1 /product="uncharacterized protein LOC131997146" /protein_id="XP_059223579.1" /db_xref="GeneID:131997146" /translation="MEVLNPRFTGLTNFHVMEWLRSINHTKKKCGLRNLATITNETQQ FLEESPCKYQSRESIRGFLNDMEPYTLSMKELFKMINDPPSSALHIQLLFKESEERLS EDQVNEIIRISKRHFPGPPPESN" ORIGIN 1 tcctcgattg taaactcctt tcacattgtg tactactcca catttacaaa ataaaaattg 61 taaacaaaca ataagcagag aacatggaag ttcttaatcc tcgttttact ggtttgacga 121 acttccatgt catggaatgg ctaaggagta ttaatcatac aaaaaagaag tgtggactaa 181 ggaacttggc caccatcact aatgaaaccc aacagttttt ggaggaatct ccatgcaaat 241 atcagagccg tgaaagcatt agagggtttt taaatgatat ggaaccttac acattgagta 301 tgaaggagtt gttcaagatg atcaacgacc caccttctag tgctttgcac atacagttgt 361 tatttaaaga aagtgaggaa cgtttaagcg aggaccaagt taatgaaatt atacgaatat 421 caaagagaca ctttccaggt cctccgcctg agtcaaatta ataataaaga atattagact 481 tgctgttttt ctacgtacat ata