Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367595 1029 bp mRNA linear INV 02-SEP-2023 acids protein 7-like (LOC106090378), transcript variant X2, mRNA. ACCESSION XM_059367595 VERSION XM_059367595.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1029 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1029 /gene="LOC106090378" /note="elongation of very long chain fatty acids protein 7-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106090378" CDS 62..886 /gene="LOC106090378" /codon_start=1 /product="elongation of very long chain fatty acids protein 7-like isoform X2" /protein_id="XP_059223578.1" /db_xref="GeneID:106090378" /translation="MKVLRLTVIPILDTVNTFRLDKRVSTHPVWGSPWCMIIGVILYL LVVKKWGPRFMANRKPYKIENIMMAYNCIQIIINLYIFCVSLRYSFLRSDFSWTCEPY NPNDMRPETLKLGHAGRLYLFTKYLDLLDTIFFLMRKKYNQITFLHLYHHSLVLVMVH VYCSKYFASHLTSTGVLNSFVHAVMYFYYQLSAMKLNINLQPWKRVMTNMQMLQFFLL SVHFCLPLINNSCNFDLAFLTLTFLQNVFVTILFGNFYYQSYIRKDRKSVNIKLSS" polyA_site 1029 /gene="LOC106090378" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcaggaaga agaccgattc acattggatt tgtagaggat atttcatttt aactggtcac 61 catgaaagtt ctacgcttaa cagtcatacc aatactggac actgtgaata catttcgatt 121 agataaacgt gtttctacac atcccgtatg gggtagtcct tggtgtatga ttattggagt 181 tattctatat ctgttggtgg tcaagaaatg gggacctcgt tttatggcaa atcgtaagcc 241 atataagatt gagaacatca tgatggcata caattgcata caaattatca tcaacttgta 301 tatcttttgt gtttcattgc gctactcttt cttgcggtct gatttcagct ggacttgtga 361 gccatacaac cctaatgaca tgagaccgga aacattaaag ctgggacatg cggggaggtt 421 gtaccttttc acaaaatact tggatttatt ggatacgata ttctttttga tgcgcaagaa 481 gtacaatcag ataacctttt tgcatctgta tcatcactca cttgtgttgg ttatggtgca 541 tgtgtattgt tccaaatatt tcgcttccca tttaacttca accggagtcc tcaattcctt 601 tgtacacgct gtgatgtatt tttattatca attatcggct atgaaattga atatcaactt 661 gcagccatgg aaacgtgtaa tgaccaacat gcaaatgctt caattcttct tactttctgt 721 tcatttttgt ttacctctga taaataattc gtgtaatttt gacttggcct tccttacact 781 gacttttctg caaaatgttt tcgtgactat tctctttggt aatttctatt atcagtcata 841 catacgcaag gatcgaaaga gtgttaacat taagttgtca tcttaaatgc agtgaattta 901 gaaattctta aaaaaacaaa tgtggaatat tattaggaat gtgaagatta taaaaaacaa 961 acaaattgta gaaaatttaa aaagaaataa caaataaaag agtgccaagt tcggccagat 1021 cgaatctta