Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans elongation of very long chain fatty


LOCUS       XM_059367595            1029 bp    mRNA    linear   INV 02-SEP-2023
            acids protein 7-like (LOC106090378), transcript variant X2, mRNA.
ACCESSION   XM_059367595
VERSION     XM_059367595.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1029
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1029
                     /gene="LOC106090378"
                     /note="elongation of very long chain fatty acids protein
                     7-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:106090378"
     CDS             62..886
                     /gene="LOC106090378"
                     /codon_start=1
                     /product="elongation of very long chain fatty acids
                     protein 7-like isoform X2"
                     /protein_id="XP_059223578.1"
                     /db_xref="GeneID:106090378"
                     /translation="MKVLRLTVIPILDTVNTFRLDKRVSTHPVWGSPWCMIIGVILYL
                     LVVKKWGPRFMANRKPYKIENIMMAYNCIQIIINLYIFCVSLRYSFLRSDFSWTCEPY
                     NPNDMRPETLKLGHAGRLYLFTKYLDLLDTIFFLMRKKYNQITFLHLYHHSLVLVMVH
                     VYCSKYFASHLTSTGVLNSFVHAVMYFYYQLSAMKLNINLQPWKRVMTNMQMLQFFLL
                     SVHFCLPLINNSCNFDLAFLTLTFLQNVFVTILFGNFYYQSYIRKDRKSVNIKLSS"
     polyA_site      1029
                     /gene="LOC106090378"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcaggaaga agaccgattc acattggatt tgtagaggat atttcatttt aactggtcac
       61 catgaaagtt ctacgcttaa cagtcatacc aatactggac actgtgaata catttcgatt
      121 agataaacgt gtttctacac atcccgtatg gggtagtcct tggtgtatga ttattggagt
      181 tattctatat ctgttggtgg tcaagaaatg gggacctcgt tttatggcaa atcgtaagcc
      241 atataagatt gagaacatca tgatggcata caattgcata caaattatca tcaacttgta
      301 tatcttttgt gtttcattgc gctactcttt cttgcggtct gatttcagct ggacttgtga
      361 gccatacaac cctaatgaca tgagaccgga aacattaaag ctgggacatg cggggaggtt
      421 gtaccttttc acaaaatact tggatttatt ggatacgata ttctttttga tgcgcaagaa
      481 gtacaatcag ataacctttt tgcatctgta tcatcactca cttgtgttgg ttatggtgca
      541 tgtgtattgt tccaaatatt tcgcttccca tttaacttca accggagtcc tcaattcctt
      601 tgtacacgct gtgatgtatt tttattatca attatcggct atgaaattga atatcaactt
      661 gcagccatgg aaacgtgtaa tgaccaacat gcaaatgctt caattcttct tactttctgt
      721 tcatttttgt ttacctctga taaataattc gtgtaatttt gacttggcct tccttacact
      781 gacttttctg caaaatgttt tcgtgactat tctctttggt aatttctatt atcagtcata
      841 catacgcaag gatcgaaaga gtgttaacat taagttgtca tcttaaatgc agtgaattta
      901 gaaattctta aaaaaacaaa tgtggaatat tattaggaat gtgaagatta taaaaaacaa
      961 acaaattgta gaaaatttaa aaagaaataa caaataaaag agtgccaagt tcggccagat
     1021 cgaatctta