Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106086801


LOCUS       XM_059367533             812 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086801), mRNA.
ACCESSION   XM_059367533
VERSION     XM_059367533.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..812
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..812
                     /gene="LOC106086801"
                     /note="uncharacterized LOC106086801; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:106086801"
     CDS             250..711
                     /gene="LOC106086801"
                     /codon_start=1
                     /product="uncharacterized protein LOC106086801"
                     /protein_id="XP_059223516.1"
                     /db_xref="GeneID:106086801"
                     /translation="MLKLSVQITVIIVSLCLIHSSEALLRRCFQCRSRGELGSCKDPF
                     TFNATDVEKESGVAAIPCASGWCGKVIEGGGTYAVDDYDQAIQRMCVQRGPDDNQDRC
                     ANTVYNYKKVYMCFCQGDLCNGSEKAINHRNTMKLIILGAIMLAVVYNRYI"
ORIGIN      
        1 aacattttat ctgaatgttg taacgcccca ttataaatat atatgcttgt aaacagtttt
       61 attaacgttt ttctcaaact attaacgatg gcggcggaac acagccgaat taaagcaaac
      121 ggcgttatgc tcagaggtgt tggctcagat aaaactggtg tttatttgcc actctgcaca
      181 aaagaaggtt gatgggcata tacaatagaa tcgtaaaata tatgaaatca aaaaattaaa
      241 caaataaata tgctcaaatt aagtgttcaa ataactgtga taattgtttc gttatgttta
      301 atacattcct ccgaggcatt gctaagacgt tgtttccaat gtcgttctcg aggggaattg
      361 ggtagctgta aagatccatt taccttcaac gcgacagatg ttgaaaagga atcgggagtt
      421 gcagcaattc cttgtgcgtc gggatggtgc ggcaaagtta ttgaaggggg cggaacctac
      481 gctgtagatg attacgatca agccattcaa cgcatgtgtg ttcaacgtgg acctgatgac
      541 aatcaagatc gatgcgctaa taccgtttac aactacaaaa aagtgtacat gtgcttctgt
      601 caaggtgact tgtgcaatgg cagtgagaag gcaataaatc accgaaatac aatgaaactg
      661 attatactag gtgcaataat gttagcggtg gtttacaaca gatatatata acatagaaaa
      721 acattgttat aagtgattta attgagtata tgtatacaca atcaatgatt taaaataaaa
      781 gcgtatttaa aaaaatttaa tcaaaataga ta