Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367533 812 bp mRNA linear INV 02-SEP-2023 (LOC106086801), mRNA. ACCESSION XM_059367533 VERSION XM_059367533.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..812 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..812 /gene="LOC106086801" /note="uncharacterized LOC106086801; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106086801" CDS 250..711 /gene="LOC106086801" /codon_start=1 /product="uncharacterized protein LOC106086801" /protein_id="XP_059223516.1" /db_xref="GeneID:106086801" /translation="MLKLSVQITVIIVSLCLIHSSEALLRRCFQCRSRGELGSCKDPF TFNATDVEKESGVAAIPCASGWCGKVIEGGGTYAVDDYDQAIQRMCVQRGPDDNQDRC ANTVYNYKKVYMCFCQGDLCNGSEKAINHRNTMKLIILGAIMLAVVYNRYI" ORIGIN 1 aacattttat ctgaatgttg taacgcccca ttataaatat atatgcttgt aaacagtttt 61 attaacgttt ttctcaaact attaacgatg gcggcggaac acagccgaat taaagcaaac 121 ggcgttatgc tcagaggtgt tggctcagat aaaactggtg tttatttgcc actctgcaca 181 aaagaaggtt gatgggcata tacaatagaa tcgtaaaata tatgaaatca aaaaattaaa 241 caaataaata tgctcaaatt aagtgttcaa ataactgtga taattgtttc gttatgttta 301 atacattcct ccgaggcatt gctaagacgt tgtttccaat gtcgttctcg aggggaattg 361 ggtagctgta aagatccatt taccttcaac gcgacagatg ttgaaaagga atcgggagtt 421 gcagcaattc cttgtgcgtc gggatggtgc ggcaaagtta ttgaaggggg cggaacctac 481 gctgtagatg attacgatca agccattcaa cgcatgtgtg ttcaacgtgg acctgatgac 541 aatcaagatc gatgcgctaa taccgtttac aactacaaaa aagtgtacat gtgcttctgt 601 caaggtgact tgtgcaatgg cagtgagaag gcaataaatc accgaaatac aatgaaactg 661 attatactag gtgcaataat gttagcggtg gtttacaaca gatatatata acatagaaaa 721 acattgttat aagtgattta attgagtata tgtatacaca atcaatgatt taaaataaaa 781 gcgtatttaa aaaaatttaa tcaaaataga ta