Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367531 492 bp mRNA linear INV 02-SEP-2023 inhibitor protein (LOC131997133), mRNA. ACCESSION XM_059367531 VERSION XM_059367531.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..492 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..492 /gene="LOC131997133" /note="inducible metalloproteinase inhibitor protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:131997133" CDS 76..342 /gene="LOC131997133" /codon_start=1 /product="inducible metalloproteinase inhibitor protein" /protein_id="XP_059223514.1" /db_xref="GeneID:131997133" /translation="MAKTSSRNLIIICLTLWALVAVVGAVARSCPQNEFYTDCGDSCQ TECATLNKPCLIAHFRCPDGCYCNKGYARDASGACIPIDKCPYS" polyA_site 492 /gene="LOC131997133" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgttgcttg tggagtcagt tgtgattcaa aataaggaac agaaacatct gtgtgctaat 61 taattgcaat taacaatggc caaaactagt tcccgtaatc tcattataat ctgtctgacg 121 ttgtgggctt tggtggcagt ggttggagcg gttgctagga gttgtccaca aaatgaattc 181 tataccgact gtggcgattc atgtcagaca gaatgtgcta ccctcaataa accctgtctt 241 atcgcacatt tcaggtgtcc cgatggctgt tactgcaata aaggctatgc acgagatgcc 301 agcggtgctt gtataccaat tgacaaatgt ccttacagtt agataaatgt catatcttga 361 atgagccaat gcataatttt gatctaataa ctgttgaaca taacgaaatt ggttgctgtc 421 tttttatttt gtcgccatta tgaaattgca aagagaaaaa agtttacatt aaaagaaatt 481 tacatacacg aa