Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans inducible metalloproteinase


LOCUS       XM_059367531             492 bp    mRNA    linear   INV 02-SEP-2023
            inhibitor protein (LOC131997133), mRNA.
ACCESSION   XM_059367531
VERSION     XM_059367531.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..492
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..492
                     /gene="LOC131997133"
                     /note="inducible metalloproteinase inhibitor protein;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:131997133"
     CDS             76..342
                     /gene="LOC131997133"
                     /codon_start=1
                     /product="inducible metalloproteinase inhibitor protein"
                     /protein_id="XP_059223514.1"
                     /db_xref="GeneID:131997133"
                     /translation="MAKTSSRNLIIICLTLWALVAVVGAVARSCPQNEFYTDCGDSCQ
                     TECATLNKPCLIAHFRCPDGCYCNKGYARDASGACIPIDKCPYS"
     polyA_site      492
                     /gene="LOC131997133"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgttgcttg tggagtcagt tgtgattcaa aataaggaac agaaacatct gtgtgctaat
       61 taattgcaat taacaatggc caaaactagt tcccgtaatc tcattataat ctgtctgacg
      121 ttgtgggctt tggtggcagt ggttggagcg gttgctagga gttgtccaca aaatgaattc
      181 tataccgact gtggcgattc atgtcagaca gaatgtgcta ccctcaataa accctgtctt
      241 atcgcacatt tcaggtgtcc cgatggctgt tactgcaata aaggctatgc acgagatgcc
      301 agcggtgctt gtataccaat tgacaaatgt ccttacagtt agataaatgt catatcttga
      361 atgagccaat gcataatttt gatctaataa ctgttgaaca taacgaaatt ggttgctgtc
      421 tttttatttt gtcgccatta tgaaattgca aagagaaaaa agtttacatt aaaagaaatt
      481 tacatacacg aa