Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans translation machinery-associated


LOCUS       XM_059367485             324 bp    mRNA    linear   INV 02-SEP-2023
            protein 7 homolog (LOC131997118), mRNA.
ACCESSION   XM_059367485
VERSION     XM_059367485.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..324
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..324
                     /gene="LOC131997118"
                     /note="translation machinery-associated protein 7 homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:131997118"
     CDS             41..235
                     /gene="LOC131997118"
                     /codon_start=1
                     /product="translation machinery-associated protein 7
                     homolog"
                     /protein_id="XP_059223468.1"
                     /db_xref="GeneID:131997118"
                     /translation="MSGREGGKKKPLKAPKKDAKELDDDDMAFKQKQKEAQKALEAAK
                     ANASKKGPLVGGGIKKSGKK"
     polyA_site      324
                     /gene="LOC131997118"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttcattatg tatttaataa tttaattgca gaaggaaaaa atgtccggtc gagagggtgg
       61 taagaaaaaa ccattgaagg cccccaagaa agacgccaaa gaacttgatg atgacgatat
      121 ggcctttaaa caaaaacaaa aggaagctca aaaggcgttg gaagctgcca aagctaatgc
      181 gtccaagaaa ggtcctctag tgggaggagg aatcaagaag tcgggcaaga agtaaaacac
      241 aaaattttag catttatttg caattgtccc tcaaccaagt taacaaataa atatatagat
      301 ttttttataa ttaataatat taaa