Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367485 324 bp mRNA linear INV 02-SEP-2023 protein 7 homolog (LOC131997118), mRNA. ACCESSION XM_059367485 VERSION XM_059367485.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..324 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..324 /gene="LOC131997118" /note="translation machinery-associated protein 7 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:131997118" CDS 41..235 /gene="LOC131997118" /codon_start=1 /product="translation machinery-associated protein 7 homolog" /protein_id="XP_059223468.1" /db_xref="GeneID:131997118" /translation="MSGREGGKKKPLKAPKKDAKELDDDDMAFKQKQKEAQKALEAAK ANASKKGPLVGGGIKKSGKK" polyA_site 324 /gene="LOC131997118" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttcattatg tatttaataa tttaattgca gaaggaaaaa atgtccggtc gagagggtgg 61 taagaaaaaa ccattgaagg cccccaagaa agacgccaaa gaacttgatg atgacgatat 121 ggcctttaaa caaaaacaaa aggaagctca aaaggcgttg gaagctgcca aagctaatgc 181 gtccaagaaa ggtcctctag tgggaggagg aatcaagaag tcgggcaaga agtaaaacac 241 aaaattttag catttatttg caattgtccc tcaaccaagt taacaaataa atatatagat 301 ttttttataa ttaataatat taaa