Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367484 257 bp mRNA linear INV 02-SEP-2023 (LOC106095754), transcript variant X1, mRNA. ACCESSION XM_059367484 VERSION XM_059367484.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..257 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..257 /gene="LOC106095754" /note="uncharacterized LOC106095754; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106095754" CDS 93..257 /gene="LOC106095754" /codon_start=1 /product="uncharacterized protein LOC106095754" /protein_id="XP_059223467.1" /db_xref="GeneID:106095754" /translation="MAGSAVARLASKYGAVIFFPSFTAATIFADWSHTQNWKKTQREI AKVQELLKHQ" ORIGIN 1 ctcagtaaaa gttgacttcg acttttttaa tcgatttgtc gtaagtcgaa ttttagaccc 61 tattttatat cccattattc tcataagcgt tcatggccgg tagtgctgtt gcacgtctgg 121 catcgaaata cggagcggtt atattctttc cttcattcac tgcagctact atttttgccg 181 attggtctca tacccagaac tggaagaaga ctcaaaggga aatcgctaaa gtacaagaac 241 ttttaaagca tcaatag