Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095754


LOCUS       XM_059367484             257 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095754), transcript variant X1, mRNA.
ACCESSION   XM_059367484
VERSION     XM_059367484.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..257
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..257
                     /gene="LOC106095754"
                     /note="uncharacterized LOC106095754; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106095754"
     CDS             93..257
                     /gene="LOC106095754"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095754"
                     /protein_id="XP_059223467.1"
                     /db_xref="GeneID:106095754"
                     /translation="MAGSAVARLASKYGAVIFFPSFTAATIFADWSHTQNWKKTQREI
                     AKVQELLKHQ"
ORIGIN      
        1 ctcagtaaaa gttgacttcg acttttttaa tcgatttgtc gtaagtcgaa ttttagaccc
       61 tattttatat cccattattc tcataagcgt tcatggccgg tagtgctgtt gcacgtctgg
      121 catcgaaata cggagcggtt atattctttc cttcattcac tgcagctact atttttgccg
      181 attggtctca tacccagaac tggaagaaga ctcaaaggga aatcgctaaa gtacaagaac
      241 ttttaaagca tcaatag