Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367478 1158 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_059367478 VERSION XM_059367478.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1158 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1158 /gene="LOC106091850" /note="vitellogenin-1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:106091850" CDS 250..1056 /gene="LOC106091850" /codon_start=1 /product="vitellogenin-1-like" /protein_id="XP_059223461.1" /db_xref="GeneID:106091850" /translation="MLRNHPQFNAVRRTVFFVAGFFAPPEIYFISDMAKAYNCRGGYN FVLYNTGTYLATLYANTAYNTGKLGRFLAIGLRNLGLSPNRIHLVGHSLGAHIVGIAG RYYYKLTGRKIARITGLDPARPCFRTPSIFPSLQRGYAQFTDIIHSNPSELGTEELLG DVDFFPGGLSPTRKGCGINIRCSHEISIQYLAESIYPGNELNFIGYQCEDYQDLARKT CSGPRSIMGFANAGRSRGMHYVPVRPESPFGANATTDDSYRFDSCGRCVS" ORIGIN 1 ctcaactttc catggtggtc tatccaatca accgtaacct atgtagaagc tctgttgtta 61 agtacggttg atgctgatgg cttcgcggat cttattttgg aaataacttc aaataaagca 121 gatttggcat gtagagctgt tgcggaagct gtttctagaa atcccctaaa tgaccctcaa 181 attgaaaagg tctcattcca actgagacta ccatgcggcc gtattgaata ctcggtaact 241 caagcgaaca tgttaaggaa tcatccccag tttaatgcgg tgcgaaggac ggtgttcttt 301 gtggcaggat tttttgctcc acctgaaata tattttattt cggacatggc aaaagcctat 361 aattgccgag gaggttacaa ctttgtgcta tacaacactg gaacttatct ggcgacttta 421 tatgccaaca ccgcctacaa caccggcaag ctgggtagat ttttggccat aggtttgcgc 481 aatctggggc tttcacccaa tcggatacat ttagttggtc atagtttggg tgcccatatt 541 gtgggtattg ctgggcgcta ttattacaaa ctaacagggc ggaaaatagc acgaatcaca 601 ggtctagatc cagcacggcc ttgttttcga actccttcca tttttccaag tttacaaaga 661 ggctacgccc aattcaccga tattatccac tcaaatccat cggaacttgg cacggaggag 721 ttattgggtg atgtagattt ctttccagga ggactctctc ccacaagaaa aggatgcgga 781 ataaatattc gttgttccca tgaaatctcc atacaatatc ttgccgaatc tatttatccc 841 ggcaatgagc taaactttat tgggtatcag tgcgaagact atcaggattt ggctaggaaa 901 acatgcagcg gccccagatc aattatgggg tttgccaatg ctggccgctc gagaggaatg 961 cattatgtgc ctgtaaggcc cgaatcacca tttggggcaa atgcaaccac cgatgactca 1021 tatcggtttg attcgtgtgg gcgatgtgtt agttgatgag aatgtgattg ggtaataaat 1081 gtctgtgata aaaaaaaaat tctgagaagt aacttttaag ttaggttgtg caaaaggtac 1141 ccaacaagac caccacag