Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans vitellogenin-1-like (LOC106091850),


LOCUS       XM_059367478            1158 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_059367478
VERSION     XM_059367478.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1158
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1158
                     /gene="LOC106091850"
                     /note="vitellogenin-1-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 14
                     Proteins"
                     /db_xref="GeneID:106091850"
     CDS             250..1056
                     /gene="LOC106091850"
                     /codon_start=1
                     /product="vitellogenin-1-like"
                     /protein_id="XP_059223461.1"
                     /db_xref="GeneID:106091850"
                     /translation="MLRNHPQFNAVRRTVFFVAGFFAPPEIYFISDMAKAYNCRGGYN
                     FVLYNTGTYLATLYANTAYNTGKLGRFLAIGLRNLGLSPNRIHLVGHSLGAHIVGIAG
                     RYYYKLTGRKIARITGLDPARPCFRTPSIFPSLQRGYAQFTDIIHSNPSELGTEELLG
                     DVDFFPGGLSPTRKGCGINIRCSHEISIQYLAESIYPGNELNFIGYQCEDYQDLARKT
                     CSGPRSIMGFANAGRSRGMHYVPVRPESPFGANATTDDSYRFDSCGRCVS"
ORIGIN      
        1 ctcaactttc catggtggtc tatccaatca accgtaacct atgtagaagc tctgttgtta
       61 agtacggttg atgctgatgg cttcgcggat cttattttgg aaataacttc aaataaagca
      121 gatttggcat gtagagctgt tgcggaagct gtttctagaa atcccctaaa tgaccctcaa
      181 attgaaaagg tctcattcca actgagacta ccatgcggcc gtattgaata ctcggtaact
      241 caagcgaaca tgttaaggaa tcatccccag tttaatgcgg tgcgaaggac ggtgttcttt
      301 gtggcaggat tttttgctcc acctgaaata tattttattt cggacatggc aaaagcctat
      361 aattgccgag gaggttacaa ctttgtgcta tacaacactg gaacttatct ggcgacttta
      421 tatgccaaca ccgcctacaa caccggcaag ctgggtagat ttttggccat aggtttgcgc
      481 aatctggggc tttcacccaa tcggatacat ttagttggtc atagtttggg tgcccatatt
      541 gtgggtattg ctgggcgcta ttattacaaa ctaacagggc ggaaaatagc acgaatcaca
      601 ggtctagatc cagcacggcc ttgttttcga actccttcca tttttccaag tttacaaaga
      661 ggctacgccc aattcaccga tattatccac tcaaatccat cggaacttgg cacggaggag
      721 ttattgggtg atgtagattt ctttccagga ggactctctc ccacaagaaa aggatgcgga
      781 ataaatattc gttgttccca tgaaatctcc atacaatatc ttgccgaatc tatttatccc
      841 ggcaatgagc taaactttat tgggtatcag tgcgaagact atcaggattt ggctaggaaa
      901 acatgcagcg gccccagatc aattatgggg tttgccaatg ctggccgctc gagaggaatg
      961 cattatgtgc ctgtaaggcc cgaatcacca tttggggcaa atgcaaccac cgatgactca
     1021 tatcggtttg attcgtgtgg gcgatgtgtt agttgatgag aatgtgattg ggtaataaat
     1081 gtctgtgata aaaaaaaaat tctgagaagt aacttttaag ttaggttgtg caaaaggtac
     1141 ccaacaagac caccacag