Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106096067


LOCUS       XM_059367467             815 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106096067), transcript variant X2, mRNA.
ACCESSION   XM_059367467
VERSION     XM_059367467.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..815
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..815
                     /gene="LOC106096067"
                     /note="uncharacterized LOC106096067; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106096067"
     CDS             216..707
                     /gene="LOC106096067"
                     /codon_start=1
                     /product="uncharacterized protein LOC106096067"
                     /protein_id="XP_059223450.1"
                     /db_xref="GeneID:106096067"
                     /translation="MSHSVTITRTTTNTSYIVLNTGYLKSFSGLLKLCQLLLGAAMVG
                     IFSYYQQNGYCFPGYDGIVFAFLMSVTFMIGTFCLLLSCLTSLSTGAIISKTIYELIY
                     HFVAAILLLACSLQVIIILSDRGHRGNKQLDAYFAAGIIGLINAALYFISTLLAHRSY
                     RGI"
     polyA_site      815
                     /gene="LOC106096067"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attataatgt atatgtatgc atgaatgtac atatattttc cgcgtatttt cttggaaaac
       61 agtttgctac gctaggaata ttcgaaatac tcttgctgag aacgataaaa gacgcgcgct
      121 actttgtctg cctcgatttc aataagtaac ccacccacct atacccagct acttttcttc
      181 caaatatcac ttctagtcct taaacagcca acaaaatgtc tcactccgtg actattactc
      241 gtaccaccac caatacttcc tacattgttt taaatactgg ctatttgaaa agtttcagtg
      301 gtcttttgaa actctgtcaa ctgcttcttg gcgctgccat ggttggcatt ttcagttact
      361 accaacaaaa tggatactgc tttcccggtt atgacggcat cgttttcgct tttctaatgt
      421 cagtgacatt tatgatagga acgttctgcc tactgttgtc atgtttgacg tcgcttagta
      481 cgggagcaat tatatcaaaa acaatttatg aattaattta tcactttgta gctgctattc
      541 tattattggc ctgctctttg caagttatca ttatattgag tgatagagga catagaggta
      601 acaaacaact ggatgcttat ttcgcggctg gcatcattgg tttgatcaat gctgcattat
      661 actttatcag tacactctta gcccaccgat cttatcgtgg tatttaaata tacaccataa
      721 aaccaaaaga aaaacagatt tcatacaaat tcgagtatag tatccaaagt aaaataaagt
      781 ttacgattac aataaaaagg aatttactta cgaaa