Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367467 815 bp mRNA linear INV 02-SEP-2023 (LOC106096067), transcript variant X2, mRNA. ACCESSION XM_059367467 VERSION XM_059367467.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..815 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..815 /gene="LOC106096067" /note="uncharacterized LOC106096067; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106096067" CDS 216..707 /gene="LOC106096067" /codon_start=1 /product="uncharacterized protein LOC106096067" /protein_id="XP_059223450.1" /db_xref="GeneID:106096067" /translation="MSHSVTITRTTTNTSYIVLNTGYLKSFSGLLKLCQLLLGAAMVG IFSYYQQNGYCFPGYDGIVFAFLMSVTFMIGTFCLLLSCLTSLSTGAIISKTIYELIY HFVAAILLLACSLQVIIILSDRGHRGNKQLDAYFAAGIIGLINAALYFISTLLAHRSY RGI" polyA_site 815 /gene="LOC106096067" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attataatgt atatgtatgc atgaatgtac atatattttc cgcgtatttt cttggaaaac 61 agtttgctac gctaggaata ttcgaaatac tcttgctgag aacgataaaa gacgcgcgct 121 actttgtctg cctcgatttc aataagtaac ccacccacct atacccagct acttttcttc 181 caaatatcac ttctagtcct taaacagcca acaaaatgtc tcactccgtg actattactc 241 gtaccaccac caatacttcc tacattgttt taaatactgg ctatttgaaa agtttcagtg 301 gtcttttgaa actctgtcaa ctgcttcttg gcgctgccat ggttggcatt ttcagttact 361 accaacaaaa tggatactgc tttcccggtt atgacggcat cgttttcgct tttctaatgt 421 cagtgacatt tatgatagga acgttctgcc tactgttgtc atgtttgacg tcgcttagta 481 cgggagcaat tatatcaaaa acaatttatg aattaattta tcactttgta gctgctattc 541 tattattggc ctgctctttg caagttatca ttatattgag tgatagagga catagaggta 601 acaaacaact ggatgcttat ttcgcggctg gcatcattgg tttgatcaat gctgcattat 661 actttatcag tacactctta gcccaccgat cttatcgtgg tatttaaata tacaccataa 721 aaccaaaaga aaaacagatt tcatacaaat tcgagtatag tatccaaagt aaaataaagt 781 ttacgattac aataaaaagg aatttactta cgaaa