Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ctenidin-1 (LOC106090248), mRNA.


LOCUS       XM_059367462             907 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_059367462
VERSION     XM_059367462.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..907
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..907
                     /gene="LOC106090248"
                     /note="ctenidin-1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 Proteins"
                     /db_xref="GeneID:106090248"
     CDS             122..829
                     /gene="LOC106090248"
                     /codon_start=1
                     /product="ctenidin-1"
                     /protein_id="XP_059223445.1"
                     /db_xref="GeneID:106090248"
                     /translation="MKRLVILLMVIAVATATPTLHKLKKKLLLGGGLAAGLGGGFGVG
                     FGGGYGGGGGGYGGHGYSGGGGGYGGHGYSGGGGGYGGHGGYGGGGYNKGSGGGYQVI
                     AVKEVPVYTVSVQKGGGGYGGGSGSGYGGGVGGGGGYGGHGGYSGGQGGYGGSGHGGY
                     SGGQGGYGGSGGYGGQGGYGANTYSNSNAGGWGGNGGGGGGGCNSCGGHNGGGGGSYA
                     TASAQASASSGSYSHGW"
     polyA_site      907
                     /gene="LOC106090248"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcttgcttt caggcacttc agtttcattc taactcttcc agactatcaa ataaaaagtt
       61 tcaatcgttc agttaggata aaagacgaga gataagatcc ggttcggttt tcgtgaggat
      121 aatgaagcgt ttggtgattt tgttaatggt gattgcggtg gctacagcca cacccaccct
      181 tcataaacta aaaaagaagc ttttgcttgg aggaggccta gccgctggct tgggaggagg
      241 atttggcgta ggcttcggtg gaggttatgg tggcggagga ggcggttatg gaggacatgg
      301 ttacagtggc ggtggaggtg gttatggtgg ccatggatat agtggtggcg gtggaggata
      361 cggtggtcat ggtggatatg gcggcggtgg ctataataaa ggcagcggag gcggatatca
      421 agtaatagct gtgaaagaag ttccagtgta tactgtatca gtgcaaaaag gaggtggtgg
      481 ctatggtggt ggttctggtt ctggctatgg tggcggtgtg ggaggaggtg ggggatatgg
      541 tggccatggc ggatatagtg gcggacaagg tggctacgga ggcagtggtc atggaggata
      601 tagtggcgga caaggtggct atggaggaag tggtgggtac ggtggccaag gtggctatgg
      661 tgctaatact tactccaaca gtaatgccgg tggttggggt ggaaatggcg gcggcggagg
      721 tggcggttgc aattcctgtg gtggccacaa tggcggtggt ggtggttcat atgctacagc
      781 cagtgctcaa gcatcggcat ccagtggaag ttattcccat ggctggtaac aattcttgaa
      841 ttatctacaa aatctgtgaa attaaataag acattagtat aagttcgtta tggtaatatc
      901 ttttttt