Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367462 907 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_059367462 VERSION XM_059367462.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..907 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..907 /gene="LOC106090248" /note="ctenidin-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106090248" CDS 122..829 /gene="LOC106090248" /codon_start=1 /product="ctenidin-1" /protein_id="XP_059223445.1" /db_xref="GeneID:106090248" /translation="MKRLVILLMVIAVATATPTLHKLKKKLLLGGGLAAGLGGGFGVG FGGGYGGGGGGYGGHGYSGGGGGYGGHGYSGGGGGYGGHGGYGGGGYNKGSGGGYQVI AVKEVPVYTVSVQKGGGGYGGGSGSGYGGGVGGGGGYGGHGGYSGGQGGYGGSGHGGY SGGQGGYGGSGGYGGQGGYGANTYSNSNAGGWGGNGGGGGGGCNSCGGHNGGGGGSYA TASAQASASSGSYSHGW" polyA_site 907 /gene="LOC106090248" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctcttgcttt caggcacttc agtttcattc taactcttcc agactatcaa ataaaaagtt 61 tcaatcgttc agttaggata aaagacgaga gataagatcc ggttcggttt tcgtgaggat 121 aatgaagcgt ttggtgattt tgttaatggt gattgcggtg gctacagcca cacccaccct 181 tcataaacta aaaaagaagc ttttgcttgg aggaggccta gccgctggct tgggaggagg 241 atttggcgta ggcttcggtg gaggttatgg tggcggagga ggcggttatg gaggacatgg 301 ttacagtggc ggtggaggtg gttatggtgg ccatggatat agtggtggcg gtggaggata 361 cggtggtcat ggtggatatg gcggcggtgg ctataataaa ggcagcggag gcggatatca 421 agtaatagct gtgaaagaag ttccagtgta tactgtatca gtgcaaaaag gaggtggtgg 481 ctatggtggt ggttctggtt ctggctatgg tggcggtgtg ggaggaggtg ggggatatgg 541 tggccatggc ggatatagtg gcggacaagg tggctacgga ggcagtggtc atggaggata 601 tagtggcgga caaggtggct atggaggaag tggtgggtac ggtggccaag gtggctatgg 661 tgctaatact tactccaaca gtaatgccgg tggttggggt ggaaatggcg gcggcggagg 721 tggcggttgc aattcctgtg gtggccacaa tggcggtggt ggtggttcat atgctacagc 781 cagtgctcaa gcatcggcat ccagtggaag ttattcccat ggctggtaac aattcttgaa 841 ttatctacaa aatctgtgaa attaaataag acattagtat aagttcgtta tggtaatatc 901 ttttttt