Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367437 801 bp mRNA linear INV 02-SEP-2023 (LOC131997105), mRNA. ACCESSION XM_059367437 VERSION XM_059367437.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..801 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..801 /gene="LOC131997105" /note="uncharacterized LOC131997105; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997105" CDS 220..558 /gene="LOC131997105" /codon_start=1 /product="uncharacterized protein LOC131997105" /protein_id="XP_059223420.1" /db_xref="GeneID:131997105" /translation="MSTSDVQNNNNSSIDDEDDDWQRVTSKRKHTGSPTSVKQHAKRF NADDVPSTSTNRFVSLANNMEPDNDDDDDNATTQPEEPKPPPIFIPDVADIAKMVASI ILTVMQSPSI" ORIGIN 1 tgttttgtca gtgatagaca caacacgtat tctgcgctag acaactttct tttgtttttg 61 aattaaattc gtaccaacaa cgtgtgtgac acccaaaata ttcacctgtg acaaatatac 121 actaagtgca agtgcaccca atctgcatat aagcaataca cacccatcgc tacatagaca 181 aaacaagtct gcgtgctgag tgcactgctt gcactcagta tgtcgacgag tgatgtacag 241 aacaacaaca acagcagcat tgatgatgaa gacgatgact ggcaacgtgt aacatcaaaa 301 cgaaaacata cagggtctcc aacttcagta aagcaacatg ccaaacgttt taatgctgat 361 gatgtgcctt caacatcaac caaccgtttt gtaagtcttg caaataatat ggaacctgac 421 aatgatgatg acgatgataa tgctactacc cagcctgagg aaccgaagcc gcctccaatc 481 tttattcctg atgtggcaga tatagcaaaa atggttgcta gtataattct gacagtgatg 541 caatcaccga gtatctagat attgcatgcc agatgtacaa accaataaag ccttttcgtt 601 ctaaagaagt cgagaatgag ataaagaagc ttaaccgcaa aaagtcacct ggatacgaca 661 atattgatgg aaaaacatta aaatctctcc ctaaaagagc tataatttac ataactatat 721 tatttaatgc aatattgcga ctatcatatt tccctaccca atggaaatac gcaaaaataa 781 taatgatttt gaagcccaac a