Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367397 519 bp mRNA linear INV 02-SEP-2023 (LOC106089810), transcript variant X4, mRNA. ACCESSION XM_059367397 VERSION XM_059367397.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..519 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..519 /gene="LOC106089810" /note="uncharacterized LOC106089810; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106089810" CDS 127..504 /gene="LOC106089810" /codon_start=1 /product="uncharacterized protein LOC106089810 isoform X4" /protein_id="XP_059223380.1" /db_xref="GeneID:106089810" /translation="MASGANCGHFMMLIIVVNMNVLCRGHPAGGIVFPNDDVSRYRPK MEVENGLRTKSTQQRGSGIIIFREEMLAGAPLKPNMTPSLKVHPNDNAVNVTKQSTSP SGTIDPDEFEDDDETFDHKHQVY" ORIGIN 1 aattccattt agttgcaatt ttcaagttga ataaggcgcg cgcgaattgc ggtttgaggc 61 tttttcgaac tttgtttttg tgtgagagca acaaaaaaca aaaacaaagt aaataatttc 121 cagacaatgg caagtggagc caattgtggg cattttatga tgctaattat tgtagtaaac 181 atgaatgtac tttgccgcgg tcaccccgca gggggcatag tgtttccgaa tgatgacgtc 241 tccagatatc gaccaaaaat ggaggtcgaa aatggcttaa gaacaaaaag cactcaacaa 301 cgtggtagtg gaattattat ctttcgagaa gaaatgcttg ctggcgctcc attgaagcct 361 aatatgacgc catcgcttaa ggttcatccc aacgacaatg cagtgaacgt aacaaaacaa 421 tcaacgtcgc cttctggcac aattgatcct gatgagtttg aagatgacga tgaaactttt 481 gaccacaaac atcaagtgta ctgatctaac gctattata