Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089810


LOCUS       XM_059367397             519 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089810), transcript variant X4, mRNA.
ACCESSION   XM_059367397
VERSION     XM_059367397.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..519
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..519
                     /gene="LOC106089810"
                     /note="uncharacterized LOC106089810; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106089810"
     CDS             127..504
                     /gene="LOC106089810"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089810 isoform X4"
                     /protein_id="XP_059223380.1"
                     /db_xref="GeneID:106089810"
                     /translation="MASGANCGHFMMLIIVVNMNVLCRGHPAGGIVFPNDDVSRYRPK
                     MEVENGLRTKSTQQRGSGIIIFREEMLAGAPLKPNMTPSLKVHPNDNAVNVTKQSTSP
                     SGTIDPDEFEDDDETFDHKHQVY"
ORIGIN      
        1 aattccattt agttgcaatt ttcaagttga ataaggcgcg cgcgaattgc ggtttgaggc
       61 tttttcgaac tttgtttttg tgtgagagca acaaaaaaca aaaacaaagt aaataatttc
      121 cagacaatgg caagtggagc caattgtggg cattttatga tgctaattat tgtagtaaac
      181 atgaatgtac tttgccgcgg tcaccccgca gggggcatag tgtttccgaa tgatgacgtc
      241 tccagatatc gaccaaaaat ggaggtcgaa aatggcttaa gaacaaaaag cactcaacaa
      301 cgtggtagtg gaattattat ctttcgagaa gaaatgcttg ctggcgctcc attgaagcct
      361 aatatgacgc catcgcttaa ggttcatccc aacgacaatg cagtgaacgt aacaaaacaa
      421 tcaacgtcgc cttctggcac aattgatcct gatgagtttg aagatgacga tgaaactttt
      481 gaccacaaac atcaagtgta ctgatctaac gctattata