Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367326 1053 bp mRNA linear INV 02-SEP-2023 (LOC106081521), mRNA. ACCESSION XM_059367326 VERSION XM_059367326.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1053 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1053 /gene="LOC106081521" /note="uncharacterized LOC106081521; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106081521" CDS 84..992 /gene="LOC106081521" /codon_start=1 /product="uncharacterized protein LOC106081521" /protein_id="XP_059223309.1" /db_xref="GeneID:106081521" /translation="MATNNVSKNLKDLTPQEFTEFFNSFDLVLCDCDGVLWMGCGLAL PRAVEGVQLLKDKGKLVKFVSNNSMRSDQQYAEKFVQLGMRDYKVAKTMAWYLKNINP EAIVYPLLTPAAIEALLRYGIRVVPKQIDMNALTFSNFTQYMVEHDPPRVDAVIADAW LATSFAHLVKALQYLKDPKCQLILGAMDAMLPVNADLAIPGFLDFYEFLKKYSNKTPI TMGKPSKLLEEFVKHCFAITNPQRCLFIGDSLKSDISFGRSAGFQTLFVCSGGIDNEE AMLNTLDDYKPDYYTNSVADFIDLLP" polyA_site 1053 /gene="LOC106081521" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcaacattt tgcaaaagaa agaaattttt tgttggaaat taaatgaaaa ccaatattca 61 gtgatttcat taaacctcaa accatggcaa cgaacaacgt cagtaaaaat ctcaaagact 121 taacaccgca agagtttaca gaatttttca attcattcga tttggtttta tgcgattgtg 181 atggagttct atggatggga tgtggattgg cattacctag ggccgttgag ggagtgcagc 241 tgctaaagga taaaggcaaa ctagtgaaat ttgtatcgaa caacagcatg agatcggatc 301 aacagtatgc ggaaaaattt gttcagctgg gtatgaggga ttacaaagtg gccaaaacaa 361 tggcctggta tttgaaaaat atcaaccctg aagccattgt ttatccactg ttaaccccag 421 cagccataga agctttgctc agatacggca tcagagtggt acccaaacaa atcgacatga 481 atgctttgac ttttagcaac ttcacccagt atatggtgga acacgaccca cctagagtag 541 atgctgttat agctgatgcc tggctggcta caagttttgc gcatcttgtc aaagccttgc 601 aatacctcaa agaccccaaa tgtcaactaa tattaggagc tatggatgct atgctgccag 661 tgaatgcgga tctcgctata ccaggctttt tggattttta tgaatttctt aaaaaatatt 721 ctaataaaac tcccataaca atgggaaaac catcaaaact tttggaagaa tttgtcaaac 781 attgttttgc cataacaaat cctcagcgtt gcctatttat tggtgattcc ctaaaatcag 841 atatcagctt tggaagatct gctggtttcc agacattatt tgtgtgtagc ggcggtattg 901 acaacgaaga ggccatgcta aataccttag acgattataa accggattac tataccaaca 961 gcgttgctga tttcattgat ttattaccat gacataatat acgcaataaa atctaattga 1021 gagtgaaaag gtgataagtc cacttatatg aaa