Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106081521


LOCUS       XM_059367326            1053 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081521), mRNA.
ACCESSION   XM_059367326
VERSION     XM_059367326.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1053
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1053
                     /gene="LOC106081521"
                     /note="uncharacterized LOC106081521; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106081521"
     CDS             84..992
                     /gene="LOC106081521"
                     /codon_start=1
                     /product="uncharacterized protein LOC106081521"
                     /protein_id="XP_059223309.1"
                     /db_xref="GeneID:106081521"
                     /translation="MATNNVSKNLKDLTPQEFTEFFNSFDLVLCDCDGVLWMGCGLAL
                     PRAVEGVQLLKDKGKLVKFVSNNSMRSDQQYAEKFVQLGMRDYKVAKTMAWYLKNINP
                     EAIVYPLLTPAAIEALLRYGIRVVPKQIDMNALTFSNFTQYMVEHDPPRVDAVIADAW
                     LATSFAHLVKALQYLKDPKCQLILGAMDAMLPVNADLAIPGFLDFYEFLKKYSNKTPI
                     TMGKPSKLLEEFVKHCFAITNPQRCLFIGDSLKSDISFGRSAGFQTLFVCSGGIDNEE
                     AMLNTLDDYKPDYYTNSVADFIDLLP"
     polyA_site      1053
                     /gene="LOC106081521"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcaacattt tgcaaaagaa agaaattttt tgttggaaat taaatgaaaa ccaatattca
       61 gtgatttcat taaacctcaa accatggcaa cgaacaacgt cagtaaaaat ctcaaagact
      121 taacaccgca agagtttaca gaatttttca attcattcga tttggtttta tgcgattgtg
      181 atggagttct atggatggga tgtggattgg cattacctag ggccgttgag ggagtgcagc
      241 tgctaaagga taaaggcaaa ctagtgaaat ttgtatcgaa caacagcatg agatcggatc
      301 aacagtatgc ggaaaaattt gttcagctgg gtatgaggga ttacaaagtg gccaaaacaa
      361 tggcctggta tttgaaaaat atcaaccctg aagccattgt ttatccactg ttaaccccag
      421 cagccataga agctttgctc agatacggca tcagagtggt acccaaacaa atcgacatga
      481 atgctttgac ttttagcaac ttcacccagt atatggtgga acacgaccca cctagagtag
      541 atgctgttat agctgatgcc tggctggcta caagttttgc gcatcttgtc aaagccttgc
      601 aatacctcaa agaccccaaa tgtcaactaa tattaggagc tatggatgct atgctgccag
      661 tgaatgcgga tctcgctata ccaggctttt tggattttta tgaatttctt aaaaaatatt
      721 ctaataaaac tcccataaca atgggaaaac catcaaaact tttggaagaa tttgtcaaac
      781 attgttttgc cataacaaat cctcagcgtt gcctatttat tggtgattcc ctaaaatcag
      841 atatcagctt tggaagatct gctggtttcc agacattatt tgtgtgtagc ggcggtattg
      901 acaacgaaga ggccatgcta aataccttag acgattataa accggattac tataccaaca
      961 gcgttgctga tttcattgat ttattaccat gacataatat acgcaataaa atctaattga
     1021 gagtgaaaag gtgataagtc cacttatatg aaa