PREDICTED: Stomoxys calcitrans 50 kDa spicule matrix protein-like

LOCUS       XM_059367322             771 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997056), mRNA.
ACCESSION   XM_059367322
VERSION     XM_059367322.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..771
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..771
                     /gene="LOC131997056"
                     /note="50 kDa spicule matrix protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:131997056"
     CDS             1..771
                     /gene="LOC131997056"
                     /codon_start=1
                     /product="50 kDa spicule matrix protein-like"
                     /protein_id="XP_059223305.1"
                     /db_xref="GeneID:131997056"
                     /translation="MTEKAKRANAAASTWARQVPGHVMRNIKSLGRKYFPGKGGQPGK
                     VGQPGKGGQPGKGGQPGKGGQPGKVGQPEKGGQSGKGGQPGKGGQPGKGGQSGKGGQP
                     GKGGQPGKGGQPGKGGQPGKGGQQGKGGQPGKGGQPGKGGQQGKGGQPGKGGQQGKGG
                     QPGKGGQPGKGGQQGKGGQPGKGGQPGKGGQPGKDGQPGKGGQPGKGGQPGKGGQTGK
                     GGQTGKGGQTGKGGQPGKGGQQQWSRLQGPYRNHIPPR"
ORIGIN      
        1 atgaccgaaa aggcaaaaag ggcaaatgcc gcagcatcaa catgggcaag gcaggtgcca
       61 gggcatgtca tgcgcaacat caaatcactg ggtcgcaaat actttccggg aaagggtggc
      121 cagccgggaa aggttggcca gccgggaaag ggtggccagc cgggaaaggg tggccagccg
      181 ggaaagggtg gccagccggg aaaggttggc cagccggaaa agggtggcca gtcgggaaag
      241 ggtggccagc cgggaaaggg tggccagccg ggaaagggtg gccagtcggg aaagggtggc
      301 cagccgggaa agggtggcca gccgggaaag ggtggccagc cgggaaaggg tggccagccg
      361 ggaaagggtg gccagcaggg aaagggtggc cagccgggaa agggtggcca gccgggaaag
      421 ggtggccagc agggaaaggg tggccagcca ggaaaaggtg gccagcaggg aaagggtggc
      481 cagccgggaa agggtggcca gccgggaaag ggtggccagc agggaaaggg tggccagccg
      541 ggaaagggtg gccagccggg aaagggtggc cagccgggaa aggatggcca gccgggaaag
      601 ggtggccagc cgggaaaggg tggccagccg ggaaagggtg gccagacggg aaagggtggc
      661 cagacgggaa agggtggcca gacgggaaag ggtggccaac cgggaaaggg tggccagcaa
      721 cagtggtctc gtcttcaagg gccctacaga aaccacatac cgcctcgcta a