PREDICTED: Stomoxys calcitrans uncharacterized LOC131997055

LOCUS       XM_059367321             606 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997055), mRNA.
ACCESSION   XM_059367321
VERSION     XM_059367321.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..606
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..606
                     /gene="LOC131997055"
                     /note="uncharacterized LOC131997055; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131997055"
     CDS             1..606
                     /gene="LOC131997055"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997055"
                     /protein_id="XP_059223304.1"
                     /db_xref="GeneID:131997055"
                     /translation="MWLVYKPVSELVKVLLLIILVEGMLYEIVLENEEIFSNCPASNG
                     IHDIVDTTEFYFKMDGEAIDVGGNATCKMQGVNSTDRIDLEVEIFIFRRGVWQMTPYS
                     MRIKNFCSSMFNPTTLWYQWWFKYVPEDERLCLTHYGHIYHFTPFRVDASMEFALNVE
                     GRYKGIFLMKTFAKHIYLGLEKAGLEQAGLEQAGLEQAGLE"
ORIGIN      
        1 atgtggttag tttataaacc ggtaagcgaa ttggtaaaag ttcttctgct gatcatatta
       61 gtcgaaggaa tgctatacga aatagttttg gaaaacgagg agatcttcag caattgtcct
      121 gcatccaatg ggatacatga cattgtggac actactgagt tctatttcaa aatggatggt
      181 gaagctatcg atgtgggtgg caatgcaact tgtaaaatgc agggtgtaaa cagtacagat
      241 cgaatcgatt tggaagtaga aatatttata tttcgacgtg gagtttggca aatgacccca
      301 tattcaatgc ggatcaaaaa cttctgtagc tccatgttca atccaacgac tttgtggtat
      361 cagtggtggt ttaaatatgt accggaagat gaaaggttat gtttgactca ttatggacat
      421 atttatcact ttacaccttt tagagtggat gcatccatgg aatttgctct aaatgtggag
      481 ggccgttata agggcatttt tctgatgaaa acttttgcca agcatatcta tttaggcttg
      541 gagaaggcag gcttggagca ggcaggcttg gagcaggcag gcttggagca ggcaggcttg
      601 gagtag