Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367320 492 bp mRNA linear INV 02-SEP-2023 (LOC131997054), mRNA. ACCESSION XM_059367320 VERSION XM_059367320.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..492 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..492 /gene="LOC131997054" /note="uncharacterized LOC131997054; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:131997054" CDS 1..492 /gene="LOC131997054" /codon_start=1 /product="uncharacterized protein LOC131997054" /protein_id="XP_059223303.1" /db_xref="GeneID:131997054" /translation="MMGLDDIVDLSEINFDFDGELFDISGNVTSKMEGVDPTDRLDLE IEVFKMARGAWQMTPYSIRRKDFCRTMWNTNTLLYEWVFKYVPKEEQLCPTNYNHTYH TIPFKVNPTMEFALNMEGRYKVQFITILDIEILSNVDSDGNDTDVDLSDTAEVAKTMT VCR" ORIGIN 1 atgatgggac tggacgatat tgtggattta agcgaaatca attttgattt tgatggtgaa 61 ctttttgaca ttagcggtaa tgtcaccagc aaaatggagg gtgttgatcc aacagatcga 121 ttagatttgg agattgaagt gtttaaaatg gctcgtggcg cttggcaaat gactccatac 181 tccattagaa gaaaggattt ctgccgaaca atgtggaata ccaatacgct tttgtatgag 241 tgggttttta agtatgtgcc taaagaggag cagttatgcc ccacaaatta caatcatacc 301 tatcacacca tcccattcaa agtgaatcca actatggaat ttgccctgaa tatggaaggt 361 cgctataagg ttcagtttat tacaatactg gatattgaaa tattaagtaa tgttgacagc 421 gatggcaatg acactgatgt agacttgtct gacactgctg aggtggctaa aacgatgact 481 gtttgtcgtt aa