PREDICTED: Stomoxys calcitrans uncharacterized LOC131997054

LOCUS       XM_059367320             492 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997054), mRNA.
ACCESSION   XM_059367320
VERSION     XM_059367320.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..492
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..492
                     /gene="LOC131997054"
                     /note="uncharacterized LOC131997054; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131997054"
     CDS             1..492
                     /gene="LOC131997054"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997054"
                     /protein_id="XP_059223303.1"
                     /db_xref="GeneID:131997054"
                     /translation="MMGLDDIVDLSEINFDFDGELFDISGNVTSKMEGVDPTDRLDLE
                     IEVFKMARGAWQMTPYSIRRKDFCRTMWNTNTLLYEWVFKYVPKEEQLCPTNYNHTYH
                     TIPFKVNPTMEFALNMEGRYKVQFITILDIEILSNVDSDGNDTDVDLSDTAEVAKTMT
                     VCR"
ORIGIN      
        1 atgatgggac tggacgatat tgtggattta agcgaaatca attttgattt tgatggtgaa
       61 ctttttgaca ttagcggtaa tgtcaccagc aaaatggagg gtgttgatcc aacagatcga
      121 ttagatttgg agattgaagt gtttaaaatg gctcgtggcg cttggcaaat gactccatac
      181 tccattagaa gaaaggattt ctgccgaaca atgtggaata ccaatacgct tttgtatgag
      241 tgggttttta agtatgtgcc taaagaggag cagttatgcc ccacaaatta caatcatacc
      301 tatcacacca tcccattcaa agtgaatcca actatggaat ttgccctgaa tatggaaggt
      361 cgctataagg ttcagtttat tacaatactg gatattgaaa tattaagtaa tgttgacagc
      421 gatggcaatg acactgatgt agacttgtct gacactgctg aggtggctaa aacgatgact
      481 gtttgtcgtt aa