Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367309 1080 bp mRNA linear INV 02-SEP-2023 (LOC131997047), mRNA. ACCESSION XM_059367309 VERSION XM_059367309.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1080 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1080 /gene="LOC131997047" /note="uncharacterized LOC131997047; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131997047" CDS 1..1080 /gene="LOC131997047" /codon_start=1 /product="uncharacterized protein LOC131997047" /protein_id="XP_059223292.1" /db_xref="GeneID:131997047" /translation="MRNKILLEYRIFSKHADISLGGYYYKWALDPNTTYSQTDHYYLS HTYMVANIFSIYSTYEKMALPFQLKLWYLIGSVFVLSSLLILTCGCCKGARGRARNYI IGEDNSTPQYHLLTLAFGATMPTRQVPRYNFARFLLVCWMLTTLVLRSAYQSGMYQML RDNIQRNPPQTIADVLKQNYVILLKGTHMALAQTLPDMRNVRTLNGSFLQTFPELLQA NELTAIVTQYEYFGYFRQINAASWHRLHLVNERIYTQPLAMNVRTHSYLVEEFNRQIQ TAKTFGFDTLWARESFGNQAMKNNADYDPKMLATKNMSMKELGAVFMILIWLHVMAMV IFIIELIWHKWGAAVLRNYHKTLSK" ORIGIN 1 atgcgcaaca aaatactctt ggaatacaga attttttcca agcatgctga tatatccctg 61 gggggatatt attataaatg ggctctagat cccaacacta cttattcaca aacggatcac 121 tactacctat cgcatacgta tatggtggcg aatattttta gcatctatag tacatatgaa 181 aaaatggccc ttccatttca attgaaatta tggtatttaa ttggatctgt gtttgtcctc 241 agctcacttt taatactcac atgtggatgt tgcaaaggag cccggggtag ggcacgcaac 301 tatatcatag gcgaagacaa cagcacaccc caatatcatc tgctaacttt agcttttgga 361 gcaactatgc caacgcgtca agtgccacgt tataattttg cacgcttcct gcttgtctgc 421 tggatgttga ccactctggt gctacgcagt gcctatcaat cgggaatgta tcaaatgcta 481 cgtgacaaca tacaacgtaa tcctccgcaa acgatagcgg atgtgctcaa acagaactat 541 gtgatactgc tgaagggcac ccacatggct ttggcccaaa ctctgccgga tatgcgaaat 601 gtgcgaacat taaatggcag ctttttgcaa acatttccgg aattattgca ggcaaacgaa 661 ctgacggcca tagtaacgca atatgaatat tttggctatt ttcgacaaat taatgccgca 721 tcctggcatc gtttgcattt ggtgaatgag cgcatctaca cccaaccact ggccatgaat 781 gttcgcacac actcgtattt ggtggaggaa ttcaataggc aaattcagac ggctaaaacc 841 tttggctttg acacactatg ggctcgcgaa tcctttggaa accaagcgat gaaaaataat 901 gccgactatg atcccaagat gttggccact aagaatatgt ccatgaagga gttgggagct 961 gttttcatga ttttgatctg gttgcatgtg atggccatgg tcattttcat aatcgaactg 1021 atatggcaca aatggggagc agctgtgcta agaaattacc acaaaacact atccaaatga