Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997047


LOCUS       XM_059367309            1080 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997047), mRNA.
ACCESSION   XM_059367309
VERSION     XM_059367309.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1080
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1080
                     /gene="LOC131997047"
                     /note="uncharacterized LOC131997047; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131997047"
     CDS             1..1080
                     /gene="LOC131997047"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997047"
                     /protein_id="XP_059223292.1"
                     /db_xref="GeneID:131997047"
                     /translation="MRNKILLEYRIFSKHADISLGGYYYKWALDPNTTYSQTDHYYLS
                     HTYMVANIFSIYSTYEKMALPFQLKLWYLIGSVFVLSSLLILTCGCCKGARGRARNYI
                     IGEDNSTPQYHLLTLAFGATMPTRQVPRYNFARFLLVCWMLTTLVLRSAYQSGMYQML
                     RDNIQRNPPQTIADVLKQNYVILLKGTHMALAQTLPDMRNVRTLNGSFLQTFPELLQA
                     NELTAIVTQYEYFGYFRQINAASWHRLHLVNERIYTQPLAMNVRTHSYLVEEFNRQIQ
                     TAKTFGFDTLWARESFGNQAMKNNADYDPKMLATKNMSMKELGAVFMILIWLHVMAMV
                     IFIIELIWHKWGAAVLRNYHKTLSK"
ORIGIN      
        1 atgcgcaaca aaatactctt ggaatacaga attttttcca agcatgctga tatatccctg
       61 gggggatatt attataaatg ggctctagat cccaacacta cttattcaca aacggatcac
      121 tactacctat cgcatacgta tatggtggcg aatattttta gcatctatag tacatatgaa
      181 aaaatggccc ttccatttca attgaaatta tggtatttaa ttggatctgt gtttgtcctc
      241 agctcacttt taatactcac atgtggatgt tgcaaaggag cccggggtag ggcacgcaac
      301 tatatcatag gcgaagacaa cagcacaccc caatatcatc tgctaacttt agcttttgga
      361 gcaactatgc caacgcgtca agtgccacgt tataattttg cacgcttcct gcttgtctgc
      421 tggatgttga ccactctggt gctacgcagt gcctatcaat cgggaatgta tcaaatgcta
      481 cgtgacaaca tacaacgtaa tcctccgcaa acgatagcgg atgtgctcaa acagaactat
      541 gtgatactgc tgaagggcac ccacatggct ttggcccaaa ctctgccgga tatgcgaaat
      601 gtgcgaacat taaatggcag ctttttgcaa acatttccgg aattattgca ggcaaacgaa
      661 ctgacggcca tagtaacgca atatgaatat tttggctatt ttcgacaaat taatgccgca
      721 tcctggcatc gtttgcattt ggtgaatgag cgcatctaca cccaaccact ggccatgaat
      781 gttcgcacac actcgtattt ggtggaggaa ttcaataggc aaattcagac ggctaaaacc
      841 tttggctttg acacactatg ggctcgcgaa tcctttggaa accaagcgat gaaaaataat
      901 gccgactatg atcccaagat gttggccact aagaatatgt ccatgaagga gttgggagct
      961 gttttcatga ttttgatctg gttgcatgtg atggccatgg tcattttcat aatcgaactg
     1021 atatggcaca aatggggagc agctgtgcta agaaattacc acaaaacact atccaaatga