Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997046


LOCUS       XM_059367308             867 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997046), mRNA.
ACCESSION   XM_059367308
VERSION     XM_059367308.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..867
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..867
                     /gene="LOC131997046"
                     /note="uncharacterized LOC131997046; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131997046"
     CDS             1..867
                     /gene="LOC131997046"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997046"
                     /protein_id="XP_059223291.1"
                     /db_xref="GeneID:131997046"
                     /translation="MSVGWKFVATVIVVISFVHSSHIESSQHLYDSIRVIVNDPKSLF
                     QRKLLFYANYKPNTNTARYYFNDLVNYIAPDMANISYKILFQNQKTFRKTKTLKVLLF
                     EDRDALSYFYAKINKTGNYNLSYNLMHISTITTFDVDVITKVFAHLYRLSILNVALLV
                     NLLEEDIIMVTYFPFTPDKCHSIKPVIVNRYDPIQHQWVHKNYFPPKVRNLYGCPLTC
                     AAWNEFPYINLEYNSNGNDVTKYKGFEGKLLQFLAESLNFTTKVYILNSTEVDETFKE
                     PDLIFKEELHRY"
ORIGIN      
        1 atgtctgtcg gttggaaatt tgtagccacg gttatagtgg tcatttcatt tgtgcacagt
       61 tctcatatag aaagtagtca acatttgtac gactccatac gagtcattgt gaacgatccc
      121 aagagtctgt ttcaaaggaa acttttattt tatgccaact ataagccaaa tacgaataca
      181 gctcgctact atttcaatga tctggtcaat tacatagctc ctgatatggc caacatttcc
      241 tataaaattt tatttcaaaa tcaaaagacc tttcgcaaga caaaaacttt aaaggttttg
      301 ctttttgagg acagagatgc cctcagttat ttctatgcta aaatcaataa aaccggcaat
      361 tataatctct catacaatct aatgcacata tcgaccataa ccacattcga tgtggatgtc
      421 ataaccaaag tctttgccca tctataccgc ctgagtattc ttaatgtggc cctattggtg
      481 aatttactcg aagaggatat cataatggtg acctactttc catttacccc cgacaagtgt
      541 cacagtatta aaccggttat tgtgaatcgt tatgatccca tacaacatca gtgggtacat
      601 aaaaactatt ttccacccaa agtgcgaaat ttgtatggtt gccctttgac atgtgccgct
      661 tggaatgaat ttccctacat caatttggag tacaacagca atggtaatga tgtcaccaag
      721 tataagggat ttgaagggaa acttttgcaa tttcttgctg aatcactaaa ctttactacc
      781 aaggtgtaca tcttgaactc aacggaagta gatgagacat tcaaagaacc agatttaata
      841 ttcaaggagg aattgcatcg atattag