Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367308 867 bp mRNA linear INV 02-SEP-2023 (LOC131997046), mRNA. ACCESSION XM_059367308 VERSION XM_059367308.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..867 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..867 /gene="LOC131997046" /note="uncharacterized LOC131997046; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131997046" CDS 1..867 /gene="LOC131997046" /codon_start=1 /product="uncharacterized protein LOC131997046" /protein_id="XP_059223291.1" /db_xref="GeneID:131997046" /translation="MSVGWKFVATVIVVISFVHSSHIESSQHLYDSIRVIVNDPKSLF QRKLLFYANYKPNTNTARYYFNDLVNYIAPDMANISYKILFQNQKTFRKTKTLKVLLF EDRDALSYFYAKINKTGNYNLSYNLMHISTITTFDVDVITKVFAHLYRLSILNVALLV NLLEEDIIMVTYFPFTPDKCHSIKPVIVNRYDPIQHQWVHKNYFPPKVRNLYGCPLTC AAWNEFPYINLEYNSNGNDVTKYKGFEGKLLQFLAESLNFTTKVYILNSTEVDETFKE PDLIFKEELHRY" ORIGIN 1 atgtctgtcg gttggaaatt tgtagccacg gttatagtgg tcatttcatt tgtgcacagt 61 tctcatatag aaagtagtca acatttgtac gactccatac gagtcattgt gaacgatccc 121 aagagtctgt ttcaaaggaa acttttattt tatgccaact ataagccaaa tacgaataca 181 gctcgctact atttcaatga tctggtcaat tacatagctc ctgatatggc caacatttcc 241 tataaaattt tatttcaaaa tcaaaagacc tttcgcaaga caaaaacttt aaaggttttg 301 ctttttgagg acagagatgc cctcagttat ttctatgcta aaatcaataa aaccggcaat 361 tataatctct catacaatct aatgcacata tcgaccataa ccacattcga tgtggatgtc 421 ataaccaaag tctttgccca tctataccgc ctgagtattc ttaatgtggc cctattggtg 481 aatttactcg aagaggatat cataatggtg acctactttc catttacccc cgacaagtgt 541 cacagtatta aaccggttat tgtgaatcgt tatgatccca tacaacatca gtgggtacat 601 aaaaactatt ttccacccaa agtgcgaaat ttgtatggtt gccctttgac atgtgccgct 661 tggaatgaat ttccctacat caatttggag tacaacagca atggtaatga tgtcaccaag 721 tataagggat ttgaagggaa acttttgcaa tttcttgctg aatcactaaa ctttactacc 781 aaggtgtaca tcttgaactc aacggaagta gatgagacat tcaaagaacc agatttaata 841 ttcaaggagg aattgcatcg atattag