Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367301 924 bp mRNA linear INV 02-SEP-2023 (LOC131997042), mRNA. ACCESSION XM_059367301 VERSION XM_059367301.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..924 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..924 /gene="LOC131997042" /note="uncharacterized LOC131997042; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131997042" CDS 1..924 /gene="LOC131997042" /codon_start=1 /product="uncharacterized protein LOC131997042" /protein_id="XP_059223284.1" /db_xref="GeneID:131997042" /translation="MFDEIRYEINGVEIDRTRYLGISSTLKNYISINSIENNMMLNAG WSKETDLNKQKFNFYVPLNKLLGFSEDFTKVVLNCKHDLILLRSSTDLNACYSTTQTE KAKINITNITWRIPHVHISDETKLKIMKTIKDGKTIPITFRSWDCHFNPTFPGAVKCN WNVKLSVNRERPRFLVFAFENNKKFIHCNLTNFKVHLNSDIYPYDDLNIKFDDNRYAV LYDMYARFQQSFYLKEPQPLLSCDEFKETPITVIDVSHQNETIKAGPIDVKIEFETSQ SIPENTSAYCLIIHDRFIEYTPLTGTVRKII" ORIGIN 1 atgtttgatg aaattcgcta tgaaattaat ggtgtagaaa tagatagaac acgatatttg 61 ggcatttcaa gtaccttaaa aaactacatt tcaataaata gtattgaaaa taatatgatg 121 ctgaatgctg gctggagcaa agaaaccgat ttgaacaagc agaagttcaa tttttatgtg 181 ccactaaata agttattggg attttctgag gatttcacga aagttgtttt aaattgtaaa 241 catgacctta tactcctacg aagttccact gatttgaatg cctgctattc aactacccaa 301 acggaaaaag ctaaaattaa tataacaaat ataacatgga gaattcccca tgttcatatc 361 tcagatgaaa cgaagctaaa aataatgaaa acaattaaag atggaaagac tataccaatc 421 acgtttcgta gctgggattg tcattttaat cctacatttc ccggtgcagt caagtgcaat 481 tggaacgtta aactttctgt aaatagggag agaccacgtt ttttagtatt tgcatttgaa 541 aataacaaaa aatttatcca ttgtaactta acaaatttca aagtacattt aaattcagat 601 atttacccat acgatgacct taatataaaa tttgatgata atcgttatgc agttctttat 661 gatatgtatg caagatttca acaaagcttt tatttgaagg aaccgcaacc tctcctgtca 721 tgtgatgaat tcaaagaaac ccctataact gtaattgatg ttagtcatca aaatgagaca 781 ataaaagccg ggcctattga tgttaaaatt gaattcgaaa ccagccaatc cattcctgaa 841 aatacgtcgg catattgttt aataatacac gatcgtttca tcgaatacac acctttgact 901 ggaactgttc gaaaaatcat ttaa