PREDICTED: Stomoxys calcitrans juvenile hormone acid

LOCUS       XM_059367299             461 bp    mRNA    linear   INV 02-SEP-2023
            O-methyltransferase (LOC106094097), mRNA.
ACCESSION   XM_059367299
VERSION     XM_059367299.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 20% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..461
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..461
                     /gene="LOC106094097"
                     /note="juvenile hormone acid O-methyltransferase; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106094097"
     CDS             15..461
                     /gene="LOC106094097"
                     /codon_start=1
                     /product="juvenile hormone acid O-methyltransferase"
                     /protein_id="XP_059223282.1"
                     /db_xref="GeneID:106094097"
                     /translation="MNSPNLYQKARKAQTEDASQFLEEFFPKLNWRPDGHDSLIDIGS
                     GTGDLLYDLVHSRMPQSVERIVCSDINPNMIKFAQETYGTESKWEFQILDIENKEGFV
                     EDFRGTFDHLTSFYVLHWTKSLSWLAGHDDRRYEWLCGWAMRIYVN"
ORIGIN      
        1 tccattgagc agtaatgaat tcaccgaatt tataccagaa agcccgcaaa gcacaaaccg
       61 aagatgcatc acagtttctg gaggaattct ttcccaaact caactggcgc ccagatggtc
      121 acgatagtct aatcgatatt ggttctggca ctggtgacct attgtacgac ttggtccact
      181 ccagaatgcc ccaaagtgtc gaacgcattg tttgctctga tataaatcct aatatgataa
      241 aattcgccca agagacttat ggcaccgaat caaagtggga atttcaaatt ttggatattg
      301 aaaacaaaga aggtttcgtt gaggatttca gaggtacatt tgatcattta acatcgttct
      361 atgtgctgca ctggactaaa agcttaagct ggctggccgg tcatgacgat cgtaggtatg
      421 aatggttgtg tggctgggcc atgcgtatct atgtaaatta a