Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997039


LOCUS       XM_059367297            1077 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997039), mRNA.
ACCESSION   XM_059367297
VERSION     XM_059367297.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1077
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1077
                     /gene="LOC131997039"
                     /note="uncharacterized LOC131997039; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:131997039"
     CDS             1..1077
                     /gene="LOC131997039"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997039"
                     /protein_id="XP_059223280.1"
                     /db_xref="GeneID:131997039"
                     /translation="MCRMIQTEFHISRLRPRVKGIIHKCKTCIIFKKKPCSQIMAPLP
                     LDRCTITPPFHVTGIDFAGPFDLKSSALRRAPLLKGYVSIFVCFSTKAVHLEPCSELS
                     TAAFEAAFSRFVGRRGLPRKVVSDNGRNFVGASRKMLREFRSFIQVAASDIAERYSTQ
                     GFEWQFIPPHAPHMGGLWESAVKCFKHHFRRVAGAHLFTFEQFATLLARIEGVLNSRP
                     ISAVSEDPNDLTALTPGHFLKGAPIMSFPEPLAGDISVVNRWVKLKAIHHQFAIRWKE
                     EYLRTLQKRYKWKTTSPNVKVGDLVVVMDDLLPPSDWRLGRVSKTYSGSDRNTRIADV
                     KIASGVITRPIVKLCHLPILDQTQ"
ORIGIN      
        1 atgtgtcgta tgattcagac agaatttcac atctcacgtc tcagaccaag ggtgaagggc
       61 attattcaca agtgcaaaac gtgcatcatc ttcaagaaga agccttgctc ccagattatg
      121 gctccgctcc ctcttgacag atgtacaata acaccaccat ttcacgtgac gggcatagat
      181 ttcgcagggc cctttgatct caaaagttca gctcttcgca gagcccctct cttaaagggt
      241 tatgtaagca ttttcgtgtg cttctcaaca aaggctgtgc atttagagcc atgctccgag
      301 ctctccacgg cggcatttga agccgccttt tctcgattcg ttgggaggcg aggcctacct
      361 cgtaaggtag tatctgataa tggcaggaat ttcgtgggtg ccagtcgaaa gatgctacga
      421 gagtttagga gtttcattca ggttgcagca agcgacattg ctgagaggta ctctacacag
      481 ggctttgagt ggcagtttat accccctcat gctccacata tgggtgggct ttgggaatcg
      541 gccgtgaaat gttttaagca ccatttcagg agagtggctg gcgctcattt attcacgttc
      601 gagcaatttg ccacattact tgctcgtatt gaaggagttc tgaactctcg ccccatctct
      661 gccgtctctg aggatccgaa tgatctcacg gcgctgactc ccggacattt tttgaaaggc
      721 gctccgataa tgtcatttcc cgagcctttg gctggggata tctccgtggt aaataggtgg
      781 gtgaagttga aggccatcca tcaccagttt gctatacgat ggaaagagga gtatctgagg
      841 acgctgcaga agcgttataa atggaagacc acttctccca atgtgaaggt cggtgatctt
      901 gtagtcgtaa tggacgatct actaccgcct agtgactggc gactgggaag agtgtctaag
      961 acctacagcg gttccgatag gaacaccaga attgcggatg tgaagatcgc atccggggtc
     1021 attactcgac caatcgttaa actatgtcac ttacccatac ttgatcaaac ccaatag