Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367297 1077 bp mRNA linear INV 02-SEP-2023 (LOC131997039), mRNA. ACCESSION XM_059367297 VERSION XM_059367297.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1077 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1077 /gene="LOC131997039" /note="uncharacterized LOC131997039; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:131997039" CDS 1..1077 /gene="LOC131997039" /codon_start=1 /product="uncharacterized protein LOC131997039" /protein_id="XP_059223280.1" /db_xref="GeneID:131997039" /translation="MCRMIQTEFHISRLRPRVKGIIHKCKTCIIFKKKPCSQIMAPLP LDRCTITPPFHVTGIDFAGPFDLKSSALRRAPLLKGYVSIFVCFSTKAVHLEPCSELS TAAFEAAFSRFVGRRGLPRKVVSDNGRNFVGASRKMLREFRSFIQVAASDIAERYSTQ GFEWQFIPPHAPHMGGLWESAVKCFKHHFRRVAGAHLFTFEQFATLLARIEGVLNSRP ISAVSEDPNDLTALTPGHFLKGAPIMSFPEPLAGDISVVNRWVKLKAIHHQFAIRWKE EYLRTLQKRYKWKTTSPNVKVGDLVVVMDDLLPPSDWRLGRVSKTYSGSDRNTRIADV KIASGVITRPIVKLCHLPILDQTQ" ORIGIN 1 atgtgtcgta tgattcagac agaatttcac atctcacgtc tcagaccaag ggtgaagggc 61 attattcaca agtgcaaaac gtgcatcatc ttcaagaaga agccttgctc ccagattatg 121 gctccgctcc ctcttgacag atgtacaata acaccaccat ttcacgtgac gggcatagat 181 ttcgcagggc cctttgatct caaaagttca gctcttcgca gagcccctct cttaaagggt 241 tatgtaagca ttttcgtgtg cttctcaaca aaggctgtgc atttagagcc atgctccgag 301 ctctccacgg cggcatttga agccgccttt tctcgattcg ttgggaggcg aggcctacct 361 cgtaaggtag tatctgataa tggcaggaat ttcgtgggtg ccagtcgaaa gatgctacga 421 gagtttagga gtttcattca ggttgcagca agcgacattg ctgagaggta ctctacacag 481 ggctttgagt ggcagtttat accccctcat gctccacata tgggtgggct ttgggaatcg 541 gccgtgaaat gttttaagca ccatttcagg agagtggctg gcgctcattt attcacgttc 601 gagcaatttg ccacattact tgctcgtatt gaaggagttc tgaactctcg ccccatctct 661 gccgtctctg aggatccgaa tgatctcacg gcgctgactc ccggacattt tttgaaaggc 721 gctccgataa tgtcatttcc cgagcctttg gctggggata tctccgtggt aaataggtgg 781 gtgaagttga aggccatcca tcaccagttt gctatacgat ggaaagagga gtatctgagg 841 acgctgcaga agcgttataa atggaagacc acttctccca atgtgaaggt cggtgatctt 901 gtagtcgtaa tggacgatct actaccgcct agtgactggc gactgggaag agtgtctaag 961 acctacagcg gttccgatag gaacaccaga attgcggatg tgaagatcgc atccggggtc 1021 attactcgac caatcgttaa actatgtcac ttacccatac ttgatcaaac ccaatag