PREDICTED: Stomoxys calcitrans uncharacterized LOC131997038

LOCUS       XM_059367296             567 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997038), mRNA.
ACCESSION   XM_059367296
VERSION     XM_059367296.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..567
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..567
                     /gene="LOC131997038"
                     /note="uncharacterized LOC131997038; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997038"
     CDS             112..567
                     /gene="LOC131997038"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997038"
                     /protein_id="XP_059223279.1"
                     /db_xref="GeneID:131997038"
                     /translation="MSAQNLYKCMLCKKRHALRYCPIFIQMTVEDRRVVVRQHNYCRN
                     CLAKSHTIDDCQSADTCRKCGFRHHTMLHPRKLTFNSSSSTITTKSTSSRQQPQKKPP
                     TLARPRRQQSTSTPAQRKQPAKSRLGQRQHTASAGQQQRQPKKRYRSQS"
ORIGIN      
        1 tcatggtcct tcgaagccgt ccactgagac aaccagagac aaccatcgat tgaggtaaat
       61 cccatctaca ttgacataca tacatagttg tgtgccatcg tttcggtcaa aatgagtgcc
      121 caaaacctct acaagtgcat gttgtgcaaa aaacgccatg ccctcagata ctgcccaatt
      181 ttcatccaga tgacggtgga ggacaggagg gtagtagttc gacagcacaa ctactgccga
      241 aattgtctgg cgaaaagcca cacaattgat gactgccagt cggcagatac ttgtcgaaaa
      301 tgtgggtttc ggcatcacac catgctgcac ccacgaaaac tcaccttcaa ctccagcagc
      361 tctaccatca ccaccaaatc gacctcatca agacaacaac cccaaaagaa accaccaact
      421 ttagcacggc ctcgacgaca acaatcaaca tcaactccgg cccaacgcaa acaaccagct
      481 aaatcacgcc ttggccaacg tcaacacaca gcctcagctg gtcaacaaca gcgacaaccc
      541 aaaaaacgct acaggtctca gagttaa