PREDICTED: Stomoxys calcitrans circumsporozoite protein-like

LOCUS       XM_059367294             669 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997036), mRNA.
ACCESSION   XM_059367294
VERSION     XM_059367294.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..669
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..669
                     /gene="LOC131997036"
                     /note="circumsporozoite protein-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 127
                     Proteins"
                     /db_xref="GeneID:131997036"
     CDS             1..669
                     /gene="LOC131997036"
                     /codon_start=1
                     /product="circumsporozoite protein-like"
                     /protein_id="XP_059223277.1"
                     /db_xref="GeneID:131997036"
                     /translation="MIVLLKNKVVKVGSKSDEPGKRWIIPGITFTAARLSGTANYVGA
                     ATTDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPL
                     SDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSD
                     PLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPLSDPHSDSLSTILKNLIPNGSLCLR
                     PSSV"
ORIGIN      
        1 atgatagtgc tattgaagaa caaagttgtc aaagtcggaa gcaagagtga tgagccagga
       61 aaacggtgga tcatacctgg catcactttt actgccgctc gactctccgg caccgccaac
      121 tacgtgggag ctgcaacgac cgatcccctc tccgatcccc tctccgatcc actctccgat
      181 cccctctccg atcccctctc cgatcccctc tccgatcccc tctccgatcc cctctccgat
      241 cccctctccg atcccctctc cgatcccctc tccgatcccc tctccgatcc cctctccgat
      301 cccctctccg atcccctctc cgatcccctc tccgatcccc tctccgatcc cctctccgat
      361 cccctctccg atcccctctc cgatcccctc tccgatcccc tctccgatcc cctctccgat
      421 cccctctccg atcccctctc cgatcccctc tccgatcccc tctccgatcc cctctccgat
      481 cccctctccg atcccctctc cgatcccctc tccgatcccc tctccgatcc cctctccgat
      541 cccctctccg atcccctctc cgatcccctc tccgatcccc tctccgatcc tcactccgat
      601 tccctttcca cgatccttaa aaatcttatc ccgaatgggt ccctgtgcct gagaccgtcg
      661 tcagtctag