PREDICTED: Stomoxys calcitrans uncharacterized LOC106095641

LOCUS       XM_059367292             474 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095641), mRNA.
ACCESSION   XM_059367292
VERSION     XM_059367292.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 36% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..474
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..474
                     /gene="LOC106095641"
                     /note="uncharacterized LOC106095641; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106095641"
     CDS             1..474
                     /gene="LOC106095641"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095641"
                     /protein_id="XP_059223275.1"
                     /db_xref="GeneID:106095641"
                     /translation="MCNEEEAKGMSRLDDLAELNLVDEYADDMETILTSGNITLKIDV
                     DPKTPVPFHTEIFKWERGTWVNSIFSLYRPDLCACLFSPTEIWYELAKQLPPKDRTCP
                     PPKGHVFQLQNFSNRIELPNMSLLGDFSGKYKSIVHFKIANYTLCTSCTVDVWKS"
ORIGIN      
        1 atgtgcaatg aagaggaggc taaaggaatg tcacgattag acgacttggc tgaacttaat
       61 ttggtggatg aatatgcaga tgatatggaa accattctta ccagtggcaa tataacgtta
      121 aaaattgatg tcgatcccaa aacgccagta ccgtttcata cggaaatatt taaatgggaa
      181 cgtggtactt gggtgaattc aattttttct ctttatcgac cagatctgtg tgcctgcctt
      241 ttttcaccta ctgaaatttg gtatgagctt gcaaagcaat tgcctccaaa ggatcgtaca
      301 tgtcccccac caaagggtca tgtattccaa ctgcaaaatt tttcaaatcg tatagaattg
      361 cccaatatga gtctgcttgg cgatttctcg ggcaaataca agagcattgt tcacttcaaa
      421 attgccaatt acacattgtg cacatcatgt acagttgatg tatggaaatc ttaa