Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lipase 3-like (LOC106088338), mRNA.


LOCUS       XM_059367288            1236 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_059367288
VERSION     XM_059367288.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 16% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1236
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1236
                     /gene="LOC106088338"
                     /note="lipase 3-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 6 Proteins"
                     /db_xref="GeneID:106088338"
     CDS             1..1236
                     /gene="LOC106088338"
                     /codon_start=1
                     /product="lipase 3-like"
                     /protein_id="XP_059223271.1"
                     /db_xref="GeneID:106088338"
                     /translation="MQAFDVVAITSAMKAWFLICTFTFSFSLELGALSHNTKSTADRI
                     LDFGYHSETHKVTTTDGYGLTLFRIRPARIRDDRNPNGPVVLMMHGLMSSSDGWVING
                     PSQALAFLLAEAGYDIWLGNARGNPYSQQHRKWSNATQRFWHFSIHEIGIYDLPAIMD
                     YILHVTQQTSLHYVGHSQGCMILLILLSTHKEYNDKIRTAHLLAPVAFMKHANQFLLR
                     LIALLFARPSPLNALIGDRPLLQSQLIMDFLGGNRCRPITSYPLECSNVLFLVSGGWS
                     GYFNKTLLPSIFATHPASCSTNQYIHLAQLHVTARFHAFDFGREENLLQYSRPEPPAY
                     DLSKINTLLPIHIYYSDYDEFASKRDVEYLIQVMGKRAISHFVDLPQFTHTDFIWAIN
                     VKETINRPILDIMNQAEGT"
ORIGIN      
        1 atgcaagcat tcgatgtggt tgcaatcaca tcggcaatga aggcctggtt cttaatttgc
       61 acattcactt tcagtttcag cttagagctt ggcgctctga gccacaatac gaaatcgacg
      121 gcagatcgaa ttcttgattt tggctatcac agtgagacac ataaagtcac aacaacagat
      181 ggatatgggc tgacgttatt ccgcattagg ccggccagaa taagagatga ccgaaatccc
      241 aatgggccag ttgtattaat gatgcatggc ttaatgagtt cctctgatgg ctgggttatc
      301 aatggacctt cgcaggcttt ggctttccta ttggccgagg caggttatga catatggttg
      361 ggaaatgcca gaggcaaccc ttattcccag caacatagaa aatggtctaa cgcaacacaa
      421 cgtttttggc atttctccat acatgaaatt ggaatctatg atctgccggc cattatggat
      481 tatatactgc atgtaaccca gcaaacatct ttacactatg taggtcactc gcaaggttgc
      541 atgattttat tgattctact ctccactcat aaggagtaca acgataagat aagaacggct
      601 catttattgg ccccggtggc ctttatgaaa catgccaatc aatttctgtt gcgtttgatt
      661 gccttactct ttgcaagacc tagtccattg aatgctctca taggcgacag acccttactg
      721 caaagccagc tgataatgga ttttctggga ggcaatcgtt gccgacccat aacttcttac
      781 ccgttggagt gttccaatgt tttatttctt gtgagtggag gctggtcggg atattttaat
      841 aagactttat taccctccat ctttgctact catccggcaa gttgttccac caatcagtat
      901 atacatttgg cccaattaca tgtgaccgct agatttcatg cctttgattt tggccgtgag
      961 gaaaatctgc tgcaatattc tcgaccagaa cctcctgcct acgatctttc gaaaatcaac
     1021 acccttttac caatacacat ctattatagt gactatgatg aatttgcttc aaaacgcgat
     1081 gttgaatatc ttatccaagt tatgggtaag agggccatat cacattttgt agatctgcca
     1141 caatttaccc atacggattt tatatgggcc atcaatgtca aggaaacaat caatcggccc
     1201 atattagata taatgaatca agcagaggga acatga