PREDICTED: Stomoxys calcitrans histone H4 (LOC106092654), mRNA.

LOCUS       XM_059367287             357 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_059367287
VERSION     XM_059367287.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 14% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..357
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..357
                     /gene="LOC106092654"
                     /note="histone H4; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 13 Proteins"
                     /db_xref="GeneID:106092654"
     CDS             1..357
                     /gene="LOC106092654"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_059223270.1"
                     /db_xref="GeneID:106092654"
                     /translation="MVLNDAMLSSVSLKTEDKAKGLEKGCAKRHRKVLRDNTQGITKP
                     ANRRLARRGGVKRISGWIYEETRVVLKVLLENVIRDAFTYTEHPKRKTVTAMDGLWFE
                     VYALKRQGRTLYGFGG"
ORIGIN      
        1 atggtgttga acgatgcaat gctctcttct gtttccttga aaactgaaga caaagccaaa
       61 ggcttggaaa aaggttgcgc taaacgtcat cgtaaagtgt tgcgtgataa cacccaaggt
      121 atcaccaagc ctgcaaacag acgtttggct cgtcgtggcg gtgtaaaacg tatctctgga
      181 tggatttacg aagaaacacg tgttgtcctg aaggtgttgt tggaaaacgt tattcgtgat
      241 gctttcacct acactgaaca ccctaagcgt aaaaccgtca ccgctatgga tggtctatgg
      301 tttgaagtct atgctttgaa gagacaaggc cgcactttgt acggtttcgg cggttaa