Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367287 357 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_059367287 VERSION XM_059367287.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 14% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..357 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..357 /gene="LOC106092654" /note="histone H4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106092654" CDS 1..357 /gene="LOC106092654" /codon_start=1 /product="histone H4" /protein_id="XP_059223270.1" /db_xref="GeneID:106092654" /translation="MVLNDAMLSSVSLKTEDKAKGLEKGCAKRHRKVLRDNTQGITKP ANRRLARRGGVKRISGWIYEETRVVLKVLLENVIRDAFTYTEHPKRKTVTAMDGLWFE VYALKRQGRTLYGFGG" ORIGIN 1 atggtgttga acgatgcaat gctctcttct gtttccttga aaactgaaga caaagccaaa 61 ggcttggaaa aaggttgcgc taaacgtcat cgtaaagtgt tgcgtgataa cacccaaggt 121 atcaccaagc ctgcaaacag acgtttggct cgtcgtggcg gtgtaaaacg tatctctgga 181 tggatttacg aagaaacacg tgttgtcctg aaggtgttgt tggaaaacgt tattcgtgat 241 gctttcacct acactgaaca ccctaagcgt aaaaccgtca ccgctatgga tggtctatgg 301 tttgaagtct atgctttgaa gagacaaggc cgcactttgt acggtttcgg cggttaa