PREDICTED: Stomoxys calcitrans uncharacterized LOC106090368

LOCUS       XM_059367285             584 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090368), mRNA.
ACCESSION   XM_059367285
VERSION     XM_059367285.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 28% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..584
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..584
                     /gene="LOC106090368"
                     /note="uncharacterized LOC106090368; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106090368"
     CDS             1..573
                     /gene="LOC106090368"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090368"
                     /protein_id="XP_059223268.1"
                     /db_xref="GeneID:106090368"
                     /translation="MEFLRKSLIFCLSLVIGIEGYTTQPSMHDWEYELKSLETQSSNT
                     DLVQFYDMSIVRVSRGVYACAGTLFLNYDIVEGDSNEMEMITSYSNNPNRDFGRIPFS
                     MPRKHFFEFMNGFYKNGLMSSLKECSDFPIFEGDFVPPLEKRNYTMNNCIFSKEGFPK
                     HFKDGFYKVDIIVVGDVDWSLHFLLEIERI"
ORIGIN      
        1 atggaatttc taagaaaatc tttgattttc tgtctttcgt tggtcatagg cattgaagga
       61 tacacaaccc aacctagcat gcatgattgg gaatatgagc tgaaatcact ggaaacacaa
      121 tcctccaata cagacttagt ccagttctat gacatgagta ttgttagagt cagtcgtggt
      181 gtttacgctt gcgcaggaac cctcttcctg aattatgaca ttgtggaagg tgattccaat
      241 gagatggaga tgataacgtc ttacagcaat aacccaaata gggattttgg gcgcatacct
      301 ttctctatgc cacgaaaaca cttttttgag ttcatgaatg gtttctacaa aaatggattg
      361 atgagttcac taaaggaatg ctcggatttc cccatattcg agggagattt tgtgccacct
      421 cttgagaaga gaaactacac catgaacaat tgtattttca gcaaagaggg atttcctaaa
      481 cattttaaag atggtttcta taaggttgat attattgtgg ttggtgatgt tgactggtca
      541 ttgcattttt tactcgaaat tgaacgcatt taacggtaca ttgt