PREDICTED: Stomoxys calcitrans uncharacterized LOC131997033

LOCUS       XM_059367283             357 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997033), mRNA.
ACCESSION   XM_059367283
VERSION     XM_059367283.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..357
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..357
                     /gene="LOC131997033"
                     /note="uncharacterized LOC131997033; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131997033"
     CDS             1..357
                     /gene="LOC131997033"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997033"
                     /protein_id="XP_059223266.1"
                     /db_xref="GeneID:131997033"
                     /translation="MEYISHAWAEASKSALELLDRVQRRALVLIGDDRVSSSMVSPDH
                     RSNVGCVTLFYRYFHGVCFTDIDLLIPEVRIKNTRLSSNSLPFVIDWPAGRTMHYREN
                     LTSVSTAIVKLELVRV"
ORIGIN      
        1 atggaatata tttcacatgc atgggctgaa gcttccaaat cagccttgga acttctggac
       61 cgcgttcaga gaagagcgtt ggtgttgatt ggcgacgata gggtatccag ttctatggtt
      121 tcccctgatc atcgtagtaa tgtgggttgt gtgacgctgt tctatcgata cttccatggt
      181 gtgtgcttca cagatattga tctccttatt cctgaagtaa ggataaagaa tactagactt
      241 tctagtaact cactcccgtt tgtaattgat tggccagctg gccgcaccat gcactataga
      301 gaaaatctga cttctgtatc tacagcgata gtcaagcttg aattggtacg agtctaa