Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997031


LOCUS       XM_059367280             737 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997031), mRNA.
ACCESSION   XM_059367280
VERSION     XM_059367280.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 11% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..737
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..737
                     /gene="LOC131997031"
                     /note="uncharacterized LOC131997031; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131997031"
     CDS             75..737
                     /gene="LOC131997031"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997031"
                     /protein_id="XP_059223263.1"
                     /db_xref="GeneID:131997031"
                     /translation="MVCRLCLKAIPSESVIKLYQDLNCATEALEMVKHIEKYLDIEVR
                     QDDVVSTMICQDCHDHLEEFHKFYQDVKGKQCTRHNNFLEVELKEESHDSRDVDVKNN
                     DDSNKVDGNDKISNVAKEIEQAMFESPIDIMKTEADDEKDEQEVIATDVLDDDVDLDK
                     EDVFADDGVDIDSADLQSSEDDVPLINLKTKKKITLFCNIFELAKYANSDSSDFGVLT
                     VD"
ORIGIN      
        1 aagaagaaaa tatacacatc ccattttctt ggtgtccgag acaaaaaatt gcaaattgga
       61 aaaataccaa taaaatggtt tgccgtttgt gtctaaaagc aattcctagt gaatctgtaa
      121 taaaattata ccaagattta aactgtgcaa ctgaagcact cgaaatggta aaacatattg
      181 aaaagtacct agatattgag gttaggcaag atgatgttgt ctccacaatg atatgtcagg
      241 attgccatga ccacttggag gaatttcata aattctatca agacgtgaaa gggaagcaat
      301 gtacacgtca taacaatttt ctggaagttg agcttaaaga agaaagtcat gatagccggg
      361 atgtcgatgt taagaacaat gacgatagca acaaagtgga tggtaatgat aagattagca
      421 acgttgccaa ggaaatcgaa caagcaatgt tcgaaagtcc tattgatatc atgaaaaccg
      481 aggcagatga tgaaaaggat gagcaagaag tgatagcaac ggatgtgcta gatgatgatg
      541 tagatttgga taaagaggac gtgtttgcgg atgacggtgt tgacattgac agcgccgatt
      601 tacaatcatc agaggacgat gtacctttaa taaacttgaa aactaagaag aaaatcacat
      661 tattttgcaa tatttttgaa ttagcaaaat atgccaacag cgatagcagt gattttggag
      721 tgttgactgt tgactga