Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367280 737 bp mRNA linear INV 02-SEP-2023 (LOC131997031), mRNA. ACCESSION XM_059367280 VERSION XM_059367280.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 11% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..737 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..737 /gene="LOC131997031" /note="uncharacterized LOC131997031; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131997031" CDS 75..737 /gene="LOC131997031" /codon_start=1 /product="uncharacterized protein LOC131997031" /protein_id="XP_059223263.1" /db_xref="GeneID:131997031" /translation="MVCRLCLKAIPSESVIKLYQDLNCATEALEMVKHIEKYLDIEVR QDDVVSTMICQDCHDHLEEFHKFYQDVKGKQCTRHNNFLEVELKEESHDSRDVDVKNN DDSNKVDGNDKISNVAKEIEQAMFESPIDIMKTEADDEKDEQEVIATDVLDDDVDLDK EDVFADDGVDIDSADLQSSEDDVPLINLKTKKKITLFCNIFELAKYANSDSSDFGVLT VD" ORIGIN 1 aagaagaaaa tatacacatc ccattttctt ggtgtccgag acaaaaaatt gcaaattgga 61 aaaataccaa taaaatggtt tgccgtttgt gtctaaaagc aattcctagt gaatctgtaa 121 taaaattata ccaagattta aactgtgcaa ctgaagcact cgaaatggta aaacatattg 181 aaaagtacct agatattgag gttaggcaag atgatgttgt ctccacaatg atatgtcagg 241 attgccatga ccacttggag gaatttcata aattctatca agacgtgaaa gggaagcaat 301 gtacacgtca taacaatttt ctggaagttg agcttaaaga agaaagtcat gatagccggg 361 atgtcgatgt taagaacaat gacgatagca acaaagtgga tggtaatgat aagattagca 421 acgttgccaa ggaaatcgaa caagcaatgt tcgaaagtcc tattgatatc atgaaaaccg 481 aggcagatga tgaaaaggat gagcaagaag tgatagcaac ggatgtgcta gatgatgatg 541 tagatttgga taaagaggac gtgtttgcgg atgacggtgt tgacattgac agcgccgatt 601 tacaatcatc agaggacgat gtacctttaa taaacttgaa aactaagaag aaaatcacat 661 tattttgcaa tatttttgaa ttagcaaaat atgccaacag cgatagcagt gattttggag 721 tgttgactgt tgactga