PREDICTED: Stomoxys calcitrans uncharacterized PPE family protein

LOCUS       XM_059367279            1245 bp    mRNA    linear   INV 02-SEP-2023
            PPE54-like (LOC106090300), mRNA.
ACCESSION   XM_059367279
VERSION     XM_059367279.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1245
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1245
                     /gene="LOC106090300"
                     /note="uncharacterized PPE family protein PPE54-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:106090300"
     CDS             1..1245
                     /gene="LOC106090300"
                     /codon_start=1
                     /product="uncharacterized PPE family protein PPE54-like"
                     /protein_id="XP_059223262.1"
                     /db_xref="GeneID:106090300"
                     /translation="MKSKTAAVDDIWQMLQSNLAAGYTPYDAVTVDEQLFPYRGRICF
                     TQHIPPKPAKTTKAADFDCVALFVSDVGLSHVGLSNVGLSHAGLSDVGLSNVGLSEVG
                     LSDVSLSHVGLSDIGLSDEGLSHVSLSHVGLLDVGLSHVGLSDVGLSHVGLSHVGLSH
                     VGFSDVGLSHVGLSDVYMSNVGLSEVGLSDVGLSDEGLSHLCLPDVGLSHVVGLSDEG
                     LSHVSLSDVGLSHVGLSDVCLSNVGLSEVGLSDVGLSDEGLSHVSLSDVGVSDVALSE
                     VGLSDEGLSHAGLSIVGLLHVGLSHVGLSNVGLLHVGLSDVGVSDVGLSDVGVSDVGL
                     SDVGLSNVGMSHVGLSNVGLSNVGLSHVSLLDVGVSVVGLSNIGLSDVGLSNIGLSDV
                     GLSHVGLSDMGLSQVGLSDVGL"
ORIGIN      
        1 atgaagagca aaactgcggc ggttgatgat atttggcaaa tgttgcagtc taacttagca
       61 gcaggttaca ctccgtatga tgcagtgacc gttgatgagc agttatttcc atacagaggc
      121 cgcatctgct tcacacaaca cattccaccg aagcctgcca aaacgacaaa agcagccgat
      181 tttgattgcg ttgctctatt tgtatcggat gtgggcctgt cgcatgtcgg actttcgaat
      241 gtgggcctgt cgcatgccgg cctttcggat gtgggcctgt caaatgttgg cctgtcggaa
      301 gtgggcctgt cggatgtaag cctgtcgcat gttggcctgt ctgatatagg cctgtccgat
      361 gagggcctgt cgcatgtgag cctgtcgcat gtgggcctgt tggatgtagg cctgtcgcat
      421 gtgggcctgt cggatgtagg cctgtcgcat gtgggcctgt cgcatgtggg cctgtcgcat
      481 gtcggctttt cggatgtggg cctgtcgcat gtcggcctgt cagatgtgta catgtcgaat
      541 gttggcctgt cggaagtggg cctgtcggat gtaggcctgt ccgatgaggg cctgtcgcat
      601 ttgtgcctac cggatgtggg cctgtcgcat gtcgtgggcc tgtccgatga gggcctatcg
      661 catgtgagcc tatcggatgt gggcttgtcg catgtcggtc tgtcggatgt gtgcctgtcg
      721 aatgttggcc tgtcggaagt gggcctgtcg gatgtaggcc tgtccgatga gggcctgtcg
      781 catgtgagcc tatcggatgt gggcgtatcg gatgtggccc tgtcggaggt gggactgtcg
      841 gatgagggcc tgtcgcatgc gggcctgtcg attgtgggcc tgttgcatgt gggtctgtcg
      901 catgtgggcc tgtcgaatgt gggcctgttg catgtgggcc tgtcggatgt gggcgtatcg
      961 gatgtgggcc tgtcggatgt gggcgtatcg gatgtgggcc tgtcggatgt gggcttgtct
     1021 aatgtgggca tgtcgcatgt gggcctgtcg aatgtgggcc tgtcgaatgt aggcctgtcg
     1081 catgtaagcc tgttggatgt gggcgtatcg gttgtgggcc tgtccaatat cggcctttcg
     1141 gatgtgggcc tgtccaatat cggcctttcg gatgtgggcc tgtcgcatgt cggcctttcg
     1201 gatatgggac tgtcgcaagt cggcctgtcg gatgtgggcc tgtag