PREDICTED: Stomoxys calcitrans synaptic vesicle glycoprotein

LOCUS       XM_059367277             508 bp    mRNA    linear   INV 02-SEP-2023
            2B-like (LOC131997029), mRNA.
ACCESSION   XM_059367277
VERSION     XM_059367277.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..508
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..508
                     /gene="LOC131997029"
                     /note="synaptic vesicle glycoprotein 2B-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:131997029"
     CDS             182..508
                     /gene="LOC131997029"
                     /codon_start=1
                     /product="synaptic vesicle glycoprotein 2B-like"
                     /protein_id="XP_059223260.1"
                     /db_xref="GeneID:131997029"
                     /translation="MKSAVSKNAYAPVSQFDMDSTKTHVKDEEPKQVEKSIEAPADFE
                     TAIEACGFGRFNYLLLIVAIPAIMGTVYETGVVSFILPSAECDLSLDLLDKGLLNAVT
                     YCGKSF"
ORIGIN      
        1 cagaaaggca aaaacacatt tgaatcaata acaaaagatt cgcaccattc gaattggaat
       61 aaactaaagt ggattttata taatcggaat aacccaagga tgtccaaagg atcattgcaa
      121 taaattagta aaaagaagaa atctgtgaac aaatatatat aaaatacata catatattaa
      181 gatgaagagt gcagtgtcca aaaatgccta tgctccagtt tcccagttcg atatggattc
      241 cacaaaaaca catgtcaagg acgaagaacc caaacaagtg gagaagagca tagaggctcc
      301 tgctgatttc gagacagcca tcgaagcttg tggttttggg cgcttcaatt atttgttatt
      361 gattgtcgcc attcctgcca ttatggggac tgtatacgag acaggagtag tctcgttcat
      421 cctgcccagt gccgaatgtg atcttagcct tgatcttttg gataaaggac ttttgaatgc
      481 tgttacctac tgtggcaagt cattttaa