Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable cytochrome P450 313a4


LOCUS       XM_059367273            1419 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997026), mRNA.
ACCESSION   XM_059367273
VERSION     XM_059367273.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1419
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1419
                     /gene="LOC131997026"
                     /note="probable cytochrome P450 313a4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:131997026"
     CDS             1..1419
                     /gene="LOC131997026"
                     /codon_start=1
                     /product="probable cytochrome P450 313a4"
                     /protein_id="XP_059223256.1"
                     /db_xref="GeneID:131997026"
                     /translation="MTPVSLGVIKASFTESAKYLVILKRFCKLAEGYGKNIVEYSGPH
                     IFLVTSDPVIIKDILSSKLCVSKPDLVYDGLTNAWGKGLITLQGTQWAHQRRILNGSF
                     KNANLQAFVPVFNKKLDIMFKNIDDDIAKGQNTSLLHYMREMTLRISFETVIGRDLDK
                     TEYDVKHMAEIVSKTLEFSGDFTSNFIYLVGIVRVIAKMTKYKIAASLIVEFNNIILK
                     SMENYKRLQGIDPSYIENSEYTALENVVTAIQRNETVKEDTLGPLLHVFLGAFETSSS
                     TLYYIILLLATHPDVQQQAYEEVCNIFPEDDEGIFEVTYEQLGHLKYIEMVANEAMRI
                     WPIIPQVGRKVVGGNLKLSNGVVLPEGLRIMIDIYNVHRSKEIWGPDAHKFNPDNFQR
                     CNVEARHPYAFIPFTKGIRTCIGMKYSIINIKIALAKLLKRYRFSTRAKMEDFVFENH
                     IVLQLMQHPNIKIEKRKMSENR"
ORIGIN      
        1 atgacacctg tctctttggg agtaataaag gcttcattta ccgaaagcgc aaaatatctg
       61 gttattctaa agagattttg taagcttgct gagggttatg gcaaaaatat tgtcgaatat
      121 tcgggtccac atattttcct agtcactagt gatccggtca tcattaagga tattctatct
      181 tcaaagctgt gtgtgtctaa accagatctt gtgtatgatg gtctaacaaa tgcctgggga
      241 aaaggtctaa taactctgca aggcacccag tgggctcatc aacgaagaat ccttaatggc
      301 tcttttaaaa atgcaaattt gcaagcattt gtgccggtat tcaataaaaa attagatata
      361 atgttcaaga atatcgacga tgatattgcc aagggccaaa atacatcact acttcattat
      421 atgcgcgaaa tgacactgcg aatatctttt gagactgtga ttggaagaga tttggataaa
      481 accgaatatg acgtgaaaca catggcggag attgtttcaa agaccttgga attttcggga
      541 gactttacta gcaacttcat atatctagtt ggaattgtac gtgtaattgc aaaaatgaca
      601 aaatacaaaa ttgccgctag cttgattgtt gaatttaaca atatcatttt aaagtcaatg
      661 gaaaattaca aacgactaca aggaatcgac ccaagttata tcgaaaattc cgaatataca
      721 gccttggaga acgtagtcac agcgattcaa agaaatgaga ccgtaaaaga agatacctta
      781 ggaccattgt tgcatgtttt cttgggcgca ttcgaaacaa gctcttcgac tctctactat
      841 atcatacttt tgctggccac acatcctgat gttcaacagc aagcatacga agaggtatgc
      901 aatatctttc cagaagatga tgagggcatt tttgaggtga cctatgagca attgggtcat
      961 ctgaaataca ttgagatggt ggcaaatgag gcaatgagaa tttggcccat aataccacaa
     1021 gtgggacgta aggttgtggg tggcaattta aagctgagca atggcgtagt attgcctgag
     1081 ggcctaagaa ttatgataga catttataat gtgcatcgta gtaaggaaat atggggtccc
     1141 gatgctcaca aattcaatcc agataatttt cagcgttgca atgttgaagc gagacatccg
     1201 tatgcattca ttccttttac aaagggtatt cgaacttgta taggcatgaa atactcaata
     1261 atcaatatta aaattgcttt ggccaaattg ctcaagaggt atagattttc aacgagggcg
     1321 aagatggaag attttgtttt tgaaaatcac attgttctac aattaatgca gcatccaaat
     1381 ataaaaattg aaaaaaggaa aatgtctgaa aatagataa