Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable cytochrome P450 313a4


LOCUS       XM_059367272            1392 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997025), mRNA.
ACCESSION   XM_059367272
VERSION     XM_059367272.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 15% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1392
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1392
                     /gene="LOC131997025"
                     /note="probable cytochrome P450 313a4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:131997025"
     CDS             1..1392
                     /gene="LOC131997025"
                     /codon_start=1
                     /product="probable cytochrome P450 313a4"
                     /protein_id="XP_059223255.1"
                     /db_xref="GeneID:131997025"
                     /translation="MIIRPSSGGGLILKKFTYIAEIYGKNTLYFNGPYAFLVTSDPVT
                     IKDILTSKLCFDKPDVAYAGIKHSIGKGLIYVAGEQWYHDRKILNGAFKSAKLQALLP
                     TFNRRIGGLLHNIDRAIDSGSEVPLQSYCMNTQFSWHWQFAIKSKVETRSSSYLPAAC
                     TKQLAGLCVSKYISEMMSNVIYLIGFVRALARRTIFKEAAGTIEDALDLLAESLNNLT
                     ELRGSDPSYIESTATVVDTLEKAVHRDAITRENAKTHLMHLLSGAFETSPKTLYYTFM
                     LLAMHPDIQQLAYEEICDIFPADDDGDFDVNYKHLNQLVYLDMIINESLRLWPVVPQV
                     GRQVSGSDLKLSNGVVLPKGLRIMIDIYSLHRSQEIWGADAHKFNPDNFLPHNKDSRH
                     QYSYIPFTKGLRNCIGMRYSLIVMKIVLARLLKRYEFSTTAKIEDLVFENHVSLYLTN
                     TPELKILRRKKNA"
ORIGIN      
        1 atgattattc gcccatcctc cggtggtgga ttaatattga aaaaatttac atatattgcc
       61 gaaatctatg ggaaaaatac tttgtacttt aatggaccct atgcattttt ggtcacaagt
      121 gatcccgtaa ccattaagga tattctaact tcaaaacttt gctttgataa gcccgatgtt
      181 gcatatgctg gaattaaaca ctctattggc aaaggtttaa tatatgtggc aggagaacaa
      241 tggtaccatg acagaaaaat attaaatgga gcttttaaaa gcgcaaaact gcaagcactg
      301 ctacccacat ttaatcgcag aattggaggc ctgttacata atatcgatcg ggctatagat
      361 tctggcagcg aagtcccttt gcaaagttac tgcatgaata cacaattttc gtggcactgg
      421 caatttgcga taaagtccaa agtagaaact agatcctcaa gttacttgcc ggcagcatgt
      481 acaaagcaat tggccggttt gtgtgtttcg aagtacatat ctgaaatgat gagcaatgtt
      541 atttatttga ttggatttgt gcgagcactt gccagaagaa caatattcaa agaagcagca
      601 ggcaccattg aagacgcctt agatcttttg gcggagtcac tgaacaattt aacagaactg
      661 cgcggatctg atcccagtta cattgagagt accgcaacag tggtcgatac tttggaaaag
      721 gctgttcatc gagatgccat taccagagaa aatgctaaaa cgcatttgat gcacctgcta
      781 agtggcgctt ttgaaacaag ccccaagact ttgtactaca cattcatgct attggccatg
      841 catcccgaca tccagcaatt ggcctatgag gaaatctgtg atattttccc cgctgatgat
      901 gatggcgact tcgatgttaa ttataaacat cttaaccaac tggtctatct cgatatgata
      961 attaatgaat cccttagact ctggccagtt gtaccccaag ttggaaggca agttagtggc
     1021 agcgatctga agctgagcaa cggcgttgtc ttacccaaag gacttcgaat tatgatcgac
     1081 atttacagtt tgcaccgcag tcaggaaata tggggagcag acgctcacaa gtttaatccg
     1141 gacaactttc ttccacacaa taaagactca aggcatcaat attcgtatat tccgtttact
     1201 aaaggcctac gaaattgtat agggatgcga tattccctta tcgtaatgaa gatcgtgctg
     1261 gcaaggctac tgaagaggta cgaattctca acaacagcca aaatagaaga tctggttttt
     1321 gaaaatcatg tttcgcttta tttgacaaac accccggaac taaaaatttt aagaagaaag
     1381 aaaaatgcat aa