PREDICTED: Stomoxys calcitrans probable histone-lysine

LOCUS       XM_059367269             843 bp    mRNA    linear   INV 02-SEP-2023
            N-methyltransferase set-23 (LOC131997024), mRNA.
ACCESSION   XM_059367269
VERSION     XM_059367269.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 10% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..843
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..843
                     /gene="LOC131997024"
                     /note="probable histone-lysine N-methyltransferase set-23;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:131997024"
     CDS             1..843
                     /gene="LOC131997024"
                     /codon_start=1
                     /product="probable histone-lysine N-methyltransferase
                     set-23"
                     /protein_id="XP_059223252.1"
                     /db_xref="GeneID:131997024"
                     /translation="MELIDDYEHINADIEYVLENVLSEQTNCGIGDESIKLKELYNSV
                     LINACTCESSCSHLSTCPHGEAYVWNDKYRELVIRPERESDLIYECSSNCTCKLEDCS
                     NRLVQRGPRKNLQIFLSSQYQSYGVITKQDIPQGAFICEYAGELLTCGEAKLRIQENE
                     KKGNMNYILCLKENHHVDLAGGELKPGSELMTIVDPSKRGNIGRYLNHSCDPNCQIYS
                     VRVDCPIPKVAIFAKRHIKTGEELCFHYNDGKKYSSTSASGKPTLCLCNSKKCQKYLP
                     NLEI"
ORIGIN      
        1 atggagttaa ttgacgatta cgaacatatt aatgcagata tagaatatgt gcttgaaaat
       61 gttttaagcg aacaaacaaa ttgtggcatt ggtgatgaaa gcattaaact aaaggaattg
      121 tacaattccg ttttaataaa tgcatgcacg tgtgaaagta gttgtagcca cttatcaact
      181 tgtccacatg gtgaagctta cgtatggaat gacaaataca gagagcttgt cattaggccg
      241 gagcgagaga gtgatttaat atacgaatgc tcatcaaatt gtacatgcaa gttggaagat
      301 tgcagcaaca ggcttgtgca gcgtggtcca aggaaaaatt tacaaatttt cctttcaagt
      361 caatatcaat catatggcgt cattacaaag caggatatac cacaaggcgc cttcatatgc
      421 gaatatgctg gggaattgct aacatgtggc gaagccaagc tgcgtataca agaaaatgag
      481 aagaagggta acatgaacta cattttatgc ctaaaagaaa atcaccatgt agatcttgct
      541 ggaggagagc taaagcctgg ctcggagttg atgacaattg tagatcccag caaaagagga
      601 aatattggac gctaccttaa tcacagctgt gatcccaatt gccagatcta tagtgtgcgt
      661 gtagattgtc ccataccaaa ggtggctata tttgcaaagc gtcatataaa gacgggagaa
      721 gaattgtgct ttcattacaa cgatggaaag aaatattctt caacatcggc cagtggaaaa
      781 cctactcttt gtctttgtaa ttcgaaaaag tgtcaaaaat acttaccgaa cttggaaata
      841 taa