Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367261 801 bp mRNA linear INV 02-SEP-2023 (LOC131997019), mRNA. ACCESSION XM_059367261 VERSION XM_059367261.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..801 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..801 /gene="LOC131997019" /note="uncharacterized LOC131997019; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:131997019" CDS 1..801 /gene="LOC131997019" /codon_start=1 /product="uncharacterized protein LOC131997019" /protein_id="XP_059223244.1" /db_xref="GeneID:131997019" /translation="MKHHLKRIIGDTKLTYEEVSTVLSQIEAVLNSRPLHELSSSTED VDTITPGHFLIGRPLLEAPAKSDEGDLGCVNRWKLIQRIKNHFWRKWKEEYLTSLQNR TKWRKKERNLEVGQMVILRNEDTHPARWPLAKVTEVHTGKDGVVRVVTVKTQSGELKR PVHKLCPLEHEDERLEEKNMENLQRKNAQLSTTRRLPSILGNPTMMMIMLVNICMLMP TKATFVHELNSSTAMYLDPISQTHMSSSSWNMVIYFEMRRYLLTQQLT" ORIGIN 1 atgaagcatc acctgaaaag aattattgga gacacgaagt taacatatga agaagtgagc 61 acagtgctgt ctcagattga agcggttcta aattcaaggc ctttacacga actcagtagc 121 agcacggaag atgtcgacac aataacacca ggccacttct taattgggcg accattgtta 181 gaagctccgg cgaaaagcga tgaaggagac ttgggatgcg ttaaccggtg gaaattaata 241 caacgaataa aaaatcattt ttggagaaag tggaaggaag aatatttaac atccttgcaa 301 aatcgaacaa aatggagaaa gaaagagcgg aatttagagg ttggacaaat ggtgatacta 361 cgaaatgagg atactcaccc agctcggtgg ccactagcaa aagtcacaga agtacatacg 421 ggcaaagatg gagtggtaag agtggtgacg gttaagacac aaagtgggga attgaagaga 481 ccggtccata agttatgccc gctagagcac gaagatgaaa gattggagga gaagaatatg 541 gaaaacttgc agcggaaaaa tgcgcagtta agcacgacta ggcgattacc aagtatactg 601 ggaaatccca caatgatgat gattatgttg gtaaacattt gtatgttgat gccgactaaa 661 gctacgtttg tgcacgagct gaacagttcc acggcaatgt acttggatcc gatatcacag 721 acccatatgt catcatcttc atggaatatg gtcatatatt tcgaaatgcg aagatatttg 781 ctaacacaac agctcacgtg a