Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131997019


LOCUS       XM_059367261             801 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997019), mRNA.
ACCESSION   XM_059367261
VERSION     XM_059367261.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..801
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..801
                     /gene="LOC131997019"
                     /note="uncharacterized LOC131997019; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:131997019"
     CDS             1..801
                     /gene="LOC131997019"
                     /codon_start=1
                     /product="uncharacterized protein LOC131997019"
                     /protein_id="XP_059223244.1"
                     /db_xref="GeneID:131997019"
                     /translation="MKHHLKRIIGDTKLTYEEVSTVLSQIEAVLNSRPLHELSSSTED
                     VDTITPGHFLIGRPLLEAPAKSDEGDLGCVNRWKLIQRIKNHFWRKWKEEYLTSLQNR
                     TKWRKKERNLEVGQMVILRNEDTHPARWPLAKVTEVHTGKDGVVRVVTVKTQSGELKR
                     PVHKLCPLEHEDERLEEKNMENLQRKNAQLSTTRRLPSILGNPTMMMIMLVNICMLMP
                     TKATFVHELNSSTAMYLDPISQTHMSSSSWNMVIYFEMRRYLLTQQLT"
ORIGIN      
        1 atgaagcatc acctgaaaag aattattgga gacacgaagt taacatatga agaagtgagc
       61 acagtgctgt ctcagattga agcggttcta aattcaaggc ctttacacga actcagtagc
      121 agcacggaag atgtcgacac aataacacca ggccacttct taattgggcg accattgtta
      181 gaagctccgg cgaaaagcga tgaaggagac ttgggatgcg ttaaccggtg gaaattaata
      241 caacgaataa aaaatcattt ttggagaaag tggaaggaag aatatttaac atccttgcaa
      301 aatcgaacaa aatggagaaa gaaagagcgg aatttagagg ttggacaaat ggtgatacta
      361 cgaaatgagg atactcaccc agctcggtgg ccactagcaa aagtcacaga agtacatacg
      421 ggcaaagatg gagtggtaag agtggtgacg gttaagacac aaagtgggga attgaagaga
      481 ccggtccata agttatgccc gctagagcac gaagatgaaa gattggagga gaagaatatg
      541 gaaaacttgc agcggaaaaa tgcgcagtta agcacgacta ggcgattacc aagtatactg
      601 ggaaatccca caatgatgat gattatgttg gtaaacattt gtatgttgat gccgactaaa
      661 gctacgtttg tgcacgagct gaacagttcc acggcaatgt acttggatcc gatatcacag
      721 acccatatgt catcatcttc atggaatatg gtcatatatt tcgaaatgcg aagatatttg
      781 ctaacacaac agctcacgtg a