Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367260 594 bp mRNA linear INV 02-SEP-2023 (LOC106095960), mRNA. ACCESSION XM_059367260 VERSION XM_059367260.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..594 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..594 /gene="LOC106095960" /note="uncharacterized LOC106095960; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106095960" CDS 1..594 /gene="LOC106095960" /codon_start=1 /product="uncharacterized protein LOC106095960" /protein_id="XP_059223243.1" /db_xref="GeneID:106095960" /translation="MAMAQEEEGPPSEPSPPSEPSPPSEPSPPSEPSPPSEPSPPSEP SPPSEPSPPSEPSPPSEPSPPSEPSPPSEPSPPTEPSPPSEPSPPSEPSPPSEPSPPT EPSPPSEPSPPTEPSPPSEPSPPTEPSPPSEPSPPSEPSPPSEPSPPSEPSPPSEPSP PSTPTTKKPTEHHYNYTVHLQLFATQFVQEVSESCIV" ORIGIN 1 atggctatgg cccaagaaga agaaggccca ccatcagaac caagtccacc atcagaacca 61 agtccaccat ctgaaccaag tccaccatca gaaccaagtc caccatcaga gccaagtcca 121 ccatcagaac caagtccacc atctgaacca agtccaccat ctgaaccaag tccaccatca 181 gaaccaagtc caccatcaga accaagtcca ccatcagaac caagtccacc cacagaacca 241 agtccaccat cggaaccaag tccaccatca gaaccaagtc caccatcaga accaagtcca 301 cccacagaac caagtccacc atcagaacca agtccaccaa cagaaccaag tccaccatca 361 gaaccaagtc caccaacaga accaagtcca ccatcagaac caagtccacc atcagaacca 421 agtccaccat cagaaccaag tccaccatct gaaccaagtc caccatctga accaagtcca 481 ccatcaacac ccaccaccaa aaagccaaca gagcatcact acaattatac agttcatttg 541 caactatttg ccacccaatt cgtacaggaa gtatcagagt cttgcattgt gtaa