Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106095960


LOCUS       XM_059367260             594 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095960), mRNA.
ACCESSION   XM_059367260
VERSION     XM_059367260.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..594
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..594
                     /gene="LOC106095960"
                     /note="uncharacterized LOC106095960; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106095960"
     CDS             1..594
                     /gene="LOC106095960"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095960"
                     /protein_id="XP_059223243.1"
                     /db_xref="GeneID:106095960"
                     /translation="MAMAQEEEGPPSEPSPPSEPSPPSEPSPPSEPSPPSEPSPPSEP
                     SPPSEPSPPSEPSPPSEPSPPSEPSPPSEPSPPTEPSPPSEPSPPSEPSPPSEPSPPT
                     EPSPPSEPSPPTEPSPPSEPSPPTEPSPPSEPSPPSEPSPPSEPSPPSEPSPPSEPSP
                     PSTPTTKKPTEHHYNYTVHLQLFATQFVQEVSESCIV"
ORIGIN      
        1 atggctatgg cccaagaaga agaaggccca ccatcagaac caagtccacc atcagaacca
       61 agtccaccat ctgaaccaag tccaccatca gaaccaagtc caccatcaga gccaagtcca
      121 ccatcagaac caagtccacc atctgaacca agtccaccat ctgaaccaag tccaccatca
      181 gaaccaagtc caccatcaga accaagtcca ccatcagaac caagtccacc cacagaacca
      241 agtccaccat cggaaccaag tccaccatca gaaccaagtc caccatcaga accaagtcca
      301 cccacagaac caagtccacc atcagaacca agtccaccaa cagaaccaag tccaccatca
      361 gaaccaagtc caccaacaga accaagtcca ccatcagaac caagtccacc atcagaacca
      421 agtccaccat cagaaccaag tccaccatct gaaccaagtc caccatctga accaagtcca
      481 ccatcaacac ccaccaccaa aaagccaaca gagcatcact acaattatac agttcatttg
      541 caactatttg ccacccaatt cgtacaggaa gtatcagagt cttgcattgt gtaa