PREDICTED: Stomoxys calcitrans cation channel sperm-associated

LOCUS       XM_059367259             396 bp    mRNA    linear   INV 02-SEP-2023
            protein 2 (LOC131997018), mRNA.
ACCESSION   XM_059367259
VERSION     XM_059367259.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..396
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..396
                     /gene="LOC131997018"
                     /note="cation channel sperm-associated protein 2; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:131997018"
     CDS             1..396
                     /gene="LOC131997018"
                     /codon_start=1
                     /product="cation channel sperm-associated protein 2"
                     /protein_id="XP_059223242.1"
                     /db_xref="GeneID:131997018"
                     /translation="MKLLKLMTVTVLMAILLVQCTAKSQPEDYYDDDYDEDEDYDDSD
                     LSDTGTGDSYSGEAGSGESGESEAAGESDESGEPGSGSGQSVSKNQPKKKSSGHKKPL
                     HKKHSPKKHIKKLASRKLKKAVGRKSHRG"
ORIGIN      
        1 atgaaacttt tgaaattaat gacagttacg gtcctgatgg ccatactgct tgtccaatgt
       61 accgctaaat ctcagcctga agactattat gatgatgatt atgatgaaga tgaagattat
      121 gatgacagcg atttaagtga taccggcacc ggagattctt attcagggga ggcaggctcg
      181 ggtgaatccg gagaatcaga agcagctggc gaatcagacg aatcgggtga acccggatca
      241 ggaagcggtc aatctgtttc taaaaaccaa ccgaaaaaga agagctcggg acataaaaaa
      301 ccattacata aaaagcatag ccccaaaaaa catataaaaa aattagcatc ccgtaagctc
      361 aaaaaagctg ttggcagaaa gtctcatcgt ggctaa