PREDICTED: Stomoxys calcitrans germ cell nuclear acidic protein

LOCUS       XM_059367258             681 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095961), mRNA.
ACCESSION   XM_059367258
VERSION     XM_059367258.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..681
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..681
                     /gene="LOC106095961"
                     /note="germ cell nuclear acidic protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:106095961"
     CDS             1..681
                     /gene="LOC106095961"
                     /codon_start=1
                     /product="germ cell nuclear acidic protein"
                     /protein_id="XP_059223241.1"
                     /db_xref="GeneID:106095961"
                     /translation="MRLLKFLLLFALVALVVTQDDGDDDTTTEAADDDDTTTEAADDD
                     DTTTEAEDDDDTTESDDEDEDTTVSDTTEAGTDVTTEAGTDATTEASAETTTKKTKLL
                     VPIEGNRSGVEDTTTDAADDDDTTTEAADDDDTTEAADDDDTTTEGADDDDTTEAADD
                     DDTTESGDVDEVTDEDTTVSDTTEAGTDVTTEASAETTTKKNIITGRNVICYSGIAEI
                     SSNRFRIE"
ORIGIN      
        1 atgaggttac taaagttttt actactgttt gcccttgtgg cgttggttgt gactcaggat
       61 gatggtgatg atgacactac tacagaagcg gcggatgatg atgatactac tacagaagcg
      121 gcggacgatg atgatactac tacagaagcg gaggacgatg atgatactac agaatcggat
      181 gatgaagatg aagacactac tgtgagtgat acaacggaag ctggtactga tgtcactaca
      241 gaagctggca ccgatgctac aacagaagct tctgctgaaa caactacaaa gaaaacgaaa
      301 ctacttgtac ccatcgaagg taaccgcagt ggtgttgaag acactactac agatgcggcg
      361 gatgatgatg atactactac agaagcggcg gacgatgacg acactacaga agcggcggac
      421 gatgatgata ctactacaga aggggcagac gatgacgaca ctacagaagc ggcggacgat
      481 gatgacacaa cagaatcggg tgatgtagat gaagttaccg acgaagacac cactgtgagt
      541 gatacaacgg aagctggtac tgatgttaca acagaagctt ctgccgaaac aactacaaag
      601 aaaaatataa ttacaggaag aaatgtaata tgctacagtg gtatagcaga aattagttct
      661 aatcgcttcc gcatcgaata g