PREDICTED: Stomoxys calcitrans pre-intermoult gene 1 protein-like

LOCUS       XM_059367257             441 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131997017), mRNA.
ACCESSION   XM_059367257
VERSION     XM_059367257.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..441
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..441
                     /gene="LOC131997017"
                     /note="pre-intermoult gene 1 protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:131997017"
     CDS             1..441
                     /gene="LOC131997017"
                     /codon_start=1
                     /product="pre-intermoult gene 1 protein-like"
                     /protein_id="XP_059223240.1"
                     /db_xref="GeneID:131997017"
                     /translation="MVVNAEYVEETGDGEDTGDVGDTGDGEVTSDVEETGYGEDTGDN
                     GTEESTEENTEAESDGITESGDVIEITDEHTTVSDTTEFSAETTTKKVKTSPMKKKNK
                     RKRTRRRRNNRRKNKRRRNKRKKNKRNRNKNTNTNRRKTKKSVG"
ORIGIN      
        1 atggttgtga atgcagaata tgttgaagaa actggtgatg gtgaagatac tggcgatgta
       61 ggagatactg gtgatggtga agtaactagc gatgttgaag aaactggcta tggtgaggat
      121 actggcgata atggtaccga ggaatctact gaagagaaca ctgaagcgga aagtgatggt
      181 ataacagaat cgggggatgt aatagaaata accgatgaac atactaccgt aagtgataca
      241 acagagttta gtgctgaaac aacaacaaag aaagttaaaa catcaccaat gaaaaagaag
      301 aataagagaa aaaggacgag gaggaggaga aataacagaa gaaagaataa aagaagaagg
      361 aataagcgaa agaagaataa gcgaaataga aacaaaaata cgaacacgaa taggagaaaa
      421 accaaaaaaa gtgtgggtta a