Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367257 441 bp mRNA linear INV 02-SEP-2023 (LOC131997017), mRNA. ACCESSION XM_059367257 VERSION XM_059367257.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..441 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..441 /gene="LOC131997017" /note="pre-intermoult gene 1 protein-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:131997017" CDS 1..441 /gene="LOC131997017" /codon_start=1 /product="pre-intermoult gene 1 protein-like" /protein_id="XP_059223240.1" /db_xref="GeneID:131997017" /translation="MVVNAEYVEETGDGEDTGDVGDTGDGEVTSDVEETGYGEDTGDN GTEESTEENTEAESDGITESGDVIEITDEHTTVSDTTEFSAETTTKKVKTSPMKKKNK RKRTRRRRNNRRKNKRRRNKRKKNKRNRNKNTNTNRRKTKKSVG" ORIGIN 1 atggttgtga atgcagaata tgttgaagaa actggtgatg gtgaagatac tggcgatgta 61 ggagatactg gtgatggtga agtaactagc gatgttgaag aaactggcta tggtgaggat 121 actggcgata atggtaccga ggaatctact gaagagaaca ctgaagcgga aagtgatggt 181 ataacagaat cgggggatgt aatagaaata accgatgaac atactaccgt aagtgataca 241 acagagttta gtgctgaaac aacaacaaag aaagttaaaa catcaccaat gaaaaagaag 301 aataagagaa aaaggacgag gaggaggaga aataacagaa gaaagaataa aagaagaagg 361 aataagcgaa agaagaataa gcgaaataga aacaaaaata cgaacacgaa taggagaaaa 421 accaaaaaaa gtgtgggtta a