PREDICTED: Stomoxys calcitrans uncharacterized LOC106095977

LOCUS       XM_059367255             447 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106095977), mRNA.
ACCESSION   XM_059367255
VERSION     XM_059367255.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..447
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..447
                     /gene="LOC106095977"
                     /note="uncharacterized LOC106095977; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106095977"
     CDS             1..447
                     /gene="LOC106095977"
                     /codon_start=1
                     /product="uncharacterized protein LOC106095977"
                     /protein_id="XP_059223238.1"
                     /db_xref="GeneID:106095977"
                     /translation="MKFFKLLLLFAFVAVVVSQEEETPPEEETPPEEETPPEEETPPE
                     EETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETP
                     PEEETPPEEETPPKKKLRQRKRLPLGVGDPNSLPEEAFLRLSVEET"
ORIGIN      
        1 atgaagtttt ttaagttatt gctgctgttc gcctttgtgg cagtggtggt gagtcaggaa
       61 gaagaaactc caccagagga agaaacacca ccagaggaag aaactccacc agaggaagaa
      121 actccaccag aggaggaaac tccaccagag gaggaaactc caccagagga ggaaactcct
      181 ccggaggaag aaactcctcc agaggaagaa actccaccag aggaagaaac tcctccagag
      241 gaagaaactc cacctgaaga agaaacccca cccgaagaag aaaccccacc agaggaggaa
      301 actccccctg aagaagaaac ccctcctgag gaggaaacac ccccgaagaa gaaactccgc
      361 cagaggaaga gactcccgct gggggtgggg gatccaaaca gcctcccaga agaggcattt
      421 ctgaggctca gcgtagaaga aacctga