Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059367255 447 bp mRNA linear INV 02-SEP-2023 (LOC106095977), mRNA. ACCESSION XM_059367255 VERSION XM_059367255.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..447 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..447 /gene="LOC106095977" /note="uncharacterized LOC106095977; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106095977" CDS 1..447 /gene="LOC106095977" /codon_start=1 /product="uncharacterized protein LOC106095977" /protein_id="XP_059223238.1" /db_xref="GeneID:106095977" /translation="MKFFKLLLLFAFVAVVVSQEEETPPEEETPPEEETPPEEETPPE EETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETPPEEETP PEEETPPEEETPPKKKLRQRKRLPLGVGDPNSLPEEAFLRLSVEET" ORIGIN 1 atgaagtttt ttaagttatt gctgctgttc gcctttgtgg cagtggtggt gagtcaggaa 61 gaagaaactc caccagagga agaaacacca ccagaggaag aaactccacc agaggaagaa 121 actccaccag aggaggaaac tccaccagag gaggaaactc caccagagga ggaaactcct 181 ccggaggaag aaactcctcc agaggaagaa actccaccag aggaagaaac tcctccagag 241 gaagaaactc cacctgaaga agaaacccca cccgaagaag aaaccccacc agaggaggaa 301 actccccctg aagaagaaac ccctcctgag gaggaaacac ccccgaagaa gaaactccgc 361 cagaggaaga gactcccgct gggggtgggg gatccaaaca gcctcccaga agaggcattt 421 ctgaggctca gcgtagaaga aacctga